SitesBLAST
Comparing 7026055 FitnessBrowser__ANA3:7026055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
68% identity, 99% coverage: 1:389/391 of query aligns to 3:390/392 of P33221
- EL 22:23 (= EL 20:21) binding
- E82 (= E80) binding
- R114 (= R112) binding
- K155 (= K153) binding
- SSGKGQ 160:165 (= SSGKGQ 158:163) binding
- G162 (= G160) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ Q177) modified: N6-acetyllysine
- EGVV 195:198 (≠ EGFI 193:196) binding
- E203 (= E201) binding
- E267 (= E265) binding
- E279 (= E277) binding
- D286 (= D284) binding
- K355 (= K354) binding
- RR 362:363 (= RR 361:362) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
68% identity, 99% coverage: 1:389/391 of query aligns to 2:387/389 of 1kjiA
- active site: E114 (= E113), K154 (= K153), S159 (= S158), G161 (= G160), E264 (= E265), E276 (= E277), D283 (= D284), T284 (= T285), R360 (= R362)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R112), I152 (≠ V151), K154 (= K153), S159 (= S158), S160 (= S159), G161 (= G160), Q164 (= Q163), E192 (= E193), V195 (≠ I196), E200 (= E201), Q222 (= Q223), E264 (= E265), F266 (= F267), E276 (= E277)
- binding magnesium ion: E264 (= E265), E276 (= E277)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
68% identity, 99% coverage: 1:389/391 of query aligns to 2:387/389 of 1ez1A
- active site: E114 (= E113), K154 (= K153), S159 (= S158), G161 (= G160), E264 (= E265), E276 (= E277), D283 (= D284), T284 (= T285), R360 (= R362)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R112), I152 (≠ V151), K154 (= K153), S159 (= S158), S160 (= S159), G161 (= G160), E192 (= E193), V194 (≠ F195), V195 (≠ I196), F197 (= F198), E200 (= E201), Q222 (= Q223), E264 (= E265), F266 (= F267), E276 (= E277)
- binding glycinamide ribonucleotide: G20 (= G19), E21 (= E20), L22 (= L21), E81 (= E80), I82 (= I81), S160 (= S159), D283 (= D284), K352 (= K354), R359 (= R361), R360 (= R362)
- binding magnesium ion: E264 (= E265), E276 (= E277)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
68% identity, 99% coverage: 1:389/391 of query aligns to 2:387/389 of 1eyzA
- active site: E114 (= E113), K154 (= K153), S159 (= S158), G161 (= G160), E264 (= E265), E276 (= E277), D283 (= D284), T284 (= T285), R360 (= R362)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R112), I152 (≠ V151), K154 (= K153), S159 (= S158), S160 (= S159), G161 (= G160), Q164 (= Q163), E192 (= E193), V195 (≠ I196), F197 (= F198), E200 (= E201), E264 (= E265), F266 (= F267), E276 (= E277)
- binding magnesium ion: E264 (= E265), E276 (= E277)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
67% identity, 99% coverage: 1:389/391 of query aligns to 2:386/388 of 1kjqA
- active site: E114 (= E113), K154 (= K153), E263 (= E265), E275 (= E277), D282 (= D284), T283 (= T285), R359 (= R362)
- binding adenosine-5'-diphosphate: R113 (= R112), I152 (≠ V151), K154 (= K153), E191 (= E193), V193 (≠ F195), V194 (≠ I196), F196 (= F198), E199 (= E201), Q221 (= Q223), F265 (= F267), E275 (= E277)
- binding magnesium ion: E263 (= E265), E275 (= E277)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
67% identity, 99% coverage: 1:389/391 of query aligns to 2:384/386 of 1kjjA
- active site: E114 (= E113), K154 (= K153), S159 (= S158), G161 (= G160), E261 (= E265), E273 (= E277), D280 (= D284), T281 (= T285), R357 (= R362)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R112), I152 (≠ V151), K154 (= K153), S159 (= S158), S160 (= S159), G161 (= G160), Q164 (= Q163), E189 (= E193), V192 (≠ I196), E197 (= E201), Q219 (= Q223), E261 (= E265), F263 (= F267), E273 (= E277)
- binding magnesium ion: E261 (= E265), E273 (= E277)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
67% identity, 99% coverage: 1:389/391 of query aligns to 2:384/386 of 1kj8A
- active site: E114 (= E113), K154 (= K153), S159 (= S158), G161 (= G160), E261 (= E265), E273 (= E277), D280 (= D284), T281 (= T285), R357 (= R362)
- binding adenosine-5'-triphosphate: R113 (= R112), I152 (≠ V151), K154 (= K153), S159 (= S158), S160 (= S159), G161 (= G160), Q164 (= Q163), E189 (= E193), V192 (≠ I196), F194 (= F198), E197 (= E201), Q219 (= Q223), G222 (= G226), E261 (= E265), F263 (= F267), E273 (= E277)
- binding glycinamide ribonucleotide: G20 (= G19), E21 (= E20), L22 (= L21), E81 (= E80), I82 (= I81), S160 (= S159), D280 (= D284), K349 (= K354), R356 (= R361)
- binding magnesium ion: E261 (= E265), E273 (= E277)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
48% identity, 97% coverage: 2:380/391 of query aligns to 8:401/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
47% identity, 97% coverage: 2:380/391 of query aligns to 10:390/409 of 2dwcB
- active site: E265 (= E265), E277 (= E277), D284 (= D284), T285 (= T285), R372 (= R362)
- binding adenosine-5'-diphosphate: R120 (= R112), H159 (≠ V151), K161 (= K153), H190 (≠ F195), I191 (= I196), F193 (= F198), E196 (= E201), F267 (= F267), E277 (= E277)
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
29% identity, 87% coverage: 32:370/391 of query aligns to 21:338/360 of 3aw8A
- active site: E240 (= E265), E252 (= E277), N259 (≠ D284), S260 (≠ T285), K329 (≠ R361)
- binding adenosine monophosphate: L135 (≠ V151), K137 (= K153), Q142 (= Q163), F168 (= F195), V169 (≠ I196), E174 (= E201), H197 (≠ Q223), F242 (= F267), E252 (= E277)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
26% identity, 94% coverage: 25:390/391 of query aligns to 16:358/360 of 3ax6A
- active site: E231 (= E265), E244 (= E277), N251 (≠ D284), S252 (≠ T285), K330 (≠ R362)
- binding adenosine-5'-diphosphate: K101 (≠ R112), V136 (= V151), K138 (= K153), E164 (= E193), F166 (= F195), V167 (≠ I196), E172 (= E201), F233 (= F267), N243 (≠ S276)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
26% identity, 92% coverage: 20:380/391 of query aligns to 18:366/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (≠ E113), K147 (= K153), Q158 (= Q163), W184 (≠ F195), V185 (≠ I196), F187 (= F198), E190 (= E201), N216 (≠ G226), F257 (= F267), N267 (≠ S276), E268 (= E277)
- binding 5-aminoimidazole ribonucleotide: Q18 (≠ E20), L19 (= L21), E76 (= E80), Y153 (vs. gap), R272 (= R281), K340 (= K354), R347 (= R361)
Sites not aligning to the query:
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
26% identity, 92% coverage: 20:380/391 of query aligns to 17:365/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (≠ E113), K146 (= K153), Y152 (vs. gap), G154 (= G160), Q157 (= Q163), W183 (≠ F195), V184 (≠ I196), E189 (= E201), N215 (≠ G226), F256 (= F267), N266 (≠ S276), E267 (= E277)
- binding carbonate ion: R271 (= R281), H273 (= H283), N274 (≠ D284)
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
26% identity, 92% coverage: 20:380/391 of query aligns to 18:366/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G160), E255 (= E265), E268 (= E277), N275 (≠ D284), S276 (≠ T285), K348 (≠ R362)
- binding adenosine-5'-triphosphate: E76 (= E80), F77 (≠ I81), R107 (≠ E113), K147 (= K153), Y153 (vs. gap), D154 (≠ S159), G155 (= G160), Q158 (= Q163), W184 (≠ F195), V185 (≠ I196), F187 (= F198), E190 (= E201), E255 (= E265), F257 (= F267), N267 (≠ S276), E268 (= E277), R272 (= R281), H274 (= H283), N275 (≠ D284), K340 (= K354), R347 (= R361), K348 (≠ R362)
- binding calcium ion: E255 (= E265), E268 (= E277)
- binding phosphate ion: Q47 (= Q49), A49 (= A51)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
26% identity, 92% coverage: 20:380/391 of query aligns to 18:366/377 of 3q2oB
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
26% identity, 92% coverage: 20:380/391 of query aligns to 19:367/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (≠ E113), K148 (= K153), Y154 (vs. gap), D155 (≠ S159), G156 (= G160), Q159 (= Q163), E183 (= E193), W185 (≠ F195), V186 (≠ I196), F188 (= F198), E191 (= E201), H214 (≠ Q223), N217 (≠ G226), E256 (= E265), F258 (= F267), E269 (= E277)
- binding carbonate ion: R273 (= R281), H275 (= H283), N276 (≠ D284)
- binding magnesium ion: T105 (≠ M110), E111 (≠ R116), E256 (= E265), E269 (= E277), L270 (≠ V278)
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
30% identity, 57% coverage: 86:308/391 of query aligns to 72:290/366 of 4ma0A
- active site: Y144 (≠ S158), G146 (= G160), E247 (= E265), E259 (= E277), N266 (≠ D284), S267 (≠ T285)
- binding adenosine monophosphate: I136 (≠ V151), K138 (= K153), E175 (= E193), A176 (≠ G194), F177 (= F195), V178 (≠ I196), E183 (= E201), H206 (≠ Q223), F249 (= F267), E259 (= E277)
Sites not aligning to the query:
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
30% identity, 57% coverage: 86:308/391 of query aligns to 72:290/365 of 5jqwA
- active site: Y144 (≠ S158), G146 (= G160), E247 (= E265), E259 (= E277), N266 (≠ D284), S267 (≠ T285)
- binding adenosine-5'-diphosphate: R98 (= R112), K138 (= K153), G143 (≠ S157), Y144 (≠ S158), D145 (≠ S159), G146 (= G160), V178 (≠ I196), E183 (= E201), H206 (≠ Q223), F249 (= F267), E259 (= E277)
Sites not aligning to the query:
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
30% identity, 57% coverage: 86:308/391 of query aligns to 72:290/373 of 4mamA
- active site: Y144 (≠ S158), G146 (= G160), E247 (= E265), E259 (= E277), N266 (≠ D284), S267 (≠ T285)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R112), I136 (≠ V151), K138 (= K153), Y144 (≠ S158), G146 (= G160), Q149 (= Q163), E175 (= E193), F177 (= F195), V178 (≠ I196), F180 (= F198), E183 (= E201), H206 (≠ Q223), F249 (= F267), E259 (= E277)
Sites not aligning to the query:
3orqA Crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus complexed with adp (see paper)
26% identity, 75% coverage: 20:312/391 of query aligns to 21:304/373 of 3orqA
- active site: Y156 (vs. gap), E256 (= E265), E269 (= E277), N276 (≠ D284), S277 (≠ T285)
- binding adenosine-5'-diphosphate: R110 (= R112), K150 (= K153), Y156 (vs. gap), D157 (≠ S159), Q161 (= Q163), E185 (= E193), Y187 (≠ F195), L188 (≠ I196), I190 (≠ F198), E193 (= E201), H216 (≠ Q223), F258 (= F267), E269 (= E277)
- binding magnesium ion: E256 (= E265), E269 (= E277)
- binding pyrophosphate 2-: Y156 (vs. gap)
Sites not aligning to the query:
Query Sequence
>7026055 FitnessBrowser__ANA3:7026055
MIGTPYTEGARRAMLLGCGELGKEVAIELQRLGVEVIGVDRYPNAPAMQIAHRSHVINML
DAKALRAIIELEKPHLVIPEIEAIATQTLVEMETEGLNVVPTARATQLTMDREGIRRLAA
ETLGLPTSPYFFCDTETEFNQAIGKIGVPCVVKPVMSSSGKGQSVIRDAAQSTKAWQYAQ
EGGRAGGGRVIVEGFIPFDYEITLLTISAVNGIHFCAPIGHRQEDGDYRESWQPQAMSAD
VLAKSQAIASKVVEALGGYGLFGVELFVKGSDVYFSEVSPRPHDTGLVTLISQDLSEFAL
HVRAILGLPIPNIHQHGPSASAVVLVEGKSKNIRYQGLADALAAENTQLRLFAKPEIDGR
RRLGVALARDKDIESAVNKALDSASKVKVIF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory