SitesBLAST
Comparing 7026059 FitnessBrowser__ANA3:7026059 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
34% identity, 88% coverage: 31:310/317 of query aligns to 33:321/334 of 3kb6B
- active site: S97 (≠ G98), R231 (= R236), D255 (= D259), E260 (vs. gap), H294 (= H283)
- binding lactic acid: F49 (≠ V48), S72 (≠ A73), V73 (≠ T74), G74 (= G75), Y96 (= Y97), R231 (= R236), H294 (= H283)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ T74), Y96 (= Y97), V101 (= V102), G150 (= G156), R151 (≠ D157), I152 (= I158), D171 (≠ T177), V172 (≠ R178), P203 (= P208), T229 (= T234), A230 (= A235), R231 (= R236), H294 (= H283), A296 (= A285), Y297 (≠ W286)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 87% coverage: 34:310/317 of query aligns to 35:315/334 of 5aovA
- active site: L100 (≠ G98), R241 (= R236), D265 (= D259), E270 (= E264), H288 (= H283)
- binding glyoxylic acid: M52 (≠ N51), L53 (≠ K52), L53 (≠ K52), Y74 (≠ L72), A75 (= A73), V76 (≠ T74), G77 (= G75), R241 (= R236), H288 (= H283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T74), T104 (≠ V102), F158 (≠ Y155), G159 (= G156), R160 (≠ D157), I161 (= I158), S180 (≠ T177), R181 (= R178), A211 (≠ H206), V212 (≠ C207), P213 (= P208), T218 (= T213), I239 (≠ T234), A240 (= A235), R241 (= R236), H288 (= H283), G290 (≠ A285)
4prlA Crystal structure of d-lactate dehydrogenase with NAD+ from lactobacillus jensenii (see paper)
33% identity, 79% coverage: 66:315/317 of query aligns to 70:327/330 of 4prlA
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y97), I106 (≠ V102), V154 (≠ Y155), G155 (= G156), H156 (≠ D157), I157 (= I158), Y175 (≠ N176), D176 (≠ T177), H205 (= H206), T206 (≠ C207), P207 (= P208), A233 (≠ T234), A234 (= A235), D259 (= D259), H295 (= H283), A297 (= A285)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
36% identity, 79% coverage: 67:316/317 of query aligns to 77:335/336 of 5z20F
- active site: S108 (≠ G98), R241 (= R236), D265 (= D259), E270 (= E264), H302 (= H283)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y97), G160 (= G156), Q161 (≠ D157), I162 (= I158), Y180 (≠ V175), D181 (≠ N176), P182 (≠ T177), C212 (= C207), P213 (= P208), T218 (= T213), T239 (= T234), G240 (≠ A235), R241 (= R236), H302 (= H283), A304 (= A285)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
35% identity, 81% coverage: 55:310/317 of query aligns to 56:314/332 of 6biiA
- active site: L99 (≠ G98), R240 (= R236), D264 (= D259), E269 (= E264), H287 (= H283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T74), T103 (≠ V102), G156 (= G154), F157 (≠ Y155), G158 (= G156), R159 (≠ D157), I160 (= I158), A179 (≠ T177), R180 (= R178), S181 (≠ T179), K183 (≠ P181), V211 (≠ C207), P212 (= P208), E216 (= E212), T217 (= T213), V238 (≠ T234), A239 (= A235), R240 (= R236), D264 (= D259), H287 (= H283), G289 (≠ A285)
6p2iA Acyclic imino acid reductase (bsp5) in complex with NADPH and d-arg (see paper)
33% identity, 99% coverage: 1:313/317 of query aligns to 1:304/307 of 6p2iA
- binding d-arginine: E51 (≠ N51), T73 (≠ A73), T74 (= T74), S75 (≠ G75), Y97 (= Y97), W277 (= W286)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S98 (≠ G98), V102 (= V102), G149 (= G154), I150 (≠ Y155), G151 (= G156), Q152 (≠ D157), I153 (= I158), N172 (≠ T177), K173 (≠ R178), S174 (≠ T179), R176 (= R182), H199 (= H206), I200 (≠ C207), P201 (= P208), T206 (= T213), T227 (= T234), C228 (≠ A235), W277 (= W286)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
33% identity, 79% coverage: 56:307/317 of query aligns to 67:335/346 of 4zgsA
- active site: S111 (≠ G98), R244 (= R236), D268 (= D259), E273 (= E264), H311 (= H283)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y97), G163 (= G156), A164 (≠ D157), I165 (= I158), D184 (≠ N176), C215 (= C207), P216 (= P208), L218 (≠ T210), S220 (≠ E212), T221 (= T213), S243 (≠ A235), H311 (= H283), F314 (≠ W286)
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
34% identity, 83% coverage: 48:310/317 of query aligns to 48:316/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T74), T102 (≠ V102), G155 (= G154), G157 (= G156), R158 (≠ D157), T159 (≠ I158), D178 (vs. gap), P179 (vs. gap), Y180 (vs. gap), H210 (= H206), C211 (= C207), N212 (≠ P208), A238 (≠ T234), R240 (= R236), H289 (= H283), A291 (= A285), W292 (= W286)
Sites not aligning to the query:
4lcjA Ctbp2 in complex with substrate mtob (see paper)
34% identity, 83% coverage: 48:310/317 of query aligns to 48:316/330 of 4lcjA
- active site: A98 (≠ G98), R240 (= R236), D264 (= D259), E269 (= E264), H289 (= H283)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Y50 (≠ T50), H51 (≠ N51), I72 (≠ L72), G73 (≠ A73), S74 (≠ T74), G75 (= G75), R240 (= R236), H289 (= H283), W292 (= W286)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T74), T102 (≠ V102), I154 (= I153), G155 (= G154), G157 (= G156), R158 (≠ D157), T159 (≠ I158), D178 (vs. gap), Y180 (vs. gap), H210 (= H206), C211 (= C207), N212 (≠ P208), N214 (≠ T210), N217 (≠ T213), A238 (≠ T234), A239 (= A235), R240 (= R236), H289 (= H283), W292 (= W286)
P56545 C-terminal-binding protein 2; CtBP2 from Homo sapiens (Human)
35% identity, 81% coverage: 55:310/317 of query aligns to 87:348/445 of P56545
4lceA Ctbp1 in complex with substrate mtob (see paper)
34% identity, 83% coverage: 48:310/317 of query aligns to 48:316/327 of 4lceA
- active site: S98 (≠ G98), R240 (= R236), D264 (= D259), E269 (= E264), H289 (= H283)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (≠ V71), G73 (≠ A73), S74 (≠ T74), G75 (= G75), R240 (= R236), H289 (= H283), W292 (= W286)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T74), T102 (≠ V102), G155 (= G154), G157 (= G156), R158 (≠ D157), V159 (≠ I158), Y177 (≠ N176), D178 (vs. gap), P179 (vs. gap), Y180 (vs. gap), H210 (= H206), C211 (= C207), N214 (≠ T210), N217 (≠ T213), T238 (= T234), A239 (= A235), R240 (= R236), W292 (= W286)
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
34% identity, 83% coverage: 48:310/317 of query aligns to 49:317/332 of 6v89A
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
36% identity, 79% coverage: 60:310/317 of query aligns to 61:322/330 of 4cukA
- active site: S101 (≠ G98), R234 (= R236), D258 (= D259), E263 (vs. gap), H295 (= H283)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y97), G153 (= G156), K154 (≠ D157), I155 (= I158), F173 (≠ N176), D174 (≠ T177), P175 (vs. gap), H204 (= H206), C205 (= C207), P206 (= P208), N211 (≠ T213), T232 (= T234), Y260 (vs. gap), H295 (= H283), A297 (= A285)
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
34% identity, 83% coverage: 48:310/317 of query aligns to 49:317/328 of 4u6sA
- active site: S99 (≠ G98), R241 (= R236), D265 (= D259), E270 (= E264), H290 (= H283)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V102), G156 (= G154), G158 (= G156), R159 (≠ D157), V160 (≠ I158), Y178 (≠ N176), D179 (vs. gap), P180 (vs. gap), Y181 (vs. gap), H211 (= H206), C212 (= C207), G213 (≠ P208), N218 (≠ T213), T239 (= T234), A240 (= A235), R241 (= R236), H290 (= H283), W293 (= W286)
- binding 3-phenylpyruvic acid: Y51 (≠ T50), H52 (≠ N51), I73 (≠ L72), G74 (≠ A73), S75 (≠ T74), G76 (= G75), R241 (= R236), W293 (= W286), M302 (≠ L295)
4u6qA Ctbp1 bound to inhibitor 2-(hydroxyimino)-3-phenylpropanoic acid (see paper)
34% identity, 83% coverage: 48:310/317 of query aligns to 49:317/328 of 4u6qA
- active site: S99 (≠ G98), R241 (= R236), D265 (= D259), E270 (= E264), H290 (= H283)
- binding (2E)-2-(hydroxyimino)-3-phenylpropanoic acid: Y51 (≠ T50), I73 (≠ L72), G74 (≠ A73), S75 (≠ T74), G76 (= G75), R241 (= R236), H290 (= H283), W293 (= W286), M302 (≠ L295)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S75 (≠ T74), T103 (≠ V102), G156 (= G154), R159 (≠ D157), V160 (≠ I158), Y178 (≠ N176), D179 (vs. gap), P180 (vs. gap), Y181 (vs. gap), H211 (= H206), C212 (= C207), G213 (≠ P208), N218 (≠ T213), T239 (= T234), A240 (= A235), R241 (= R236), H290 (= H283), W293 (= W286)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
33% identity, 83% coverage: 48:310/317 of query aligns to 49:317/331 of 1hl3A
- active site: S99 (≠ G98), R241 (= R236), D265 (= D259), E270 (= E264), H290 (= H283)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V102), G158 (= G156), R159 (≠ D157), V160 (≠ I158), D179 (≠ T177), Y181 (≠ T179), H211 (= H206), C212 (= C207), G213 (≠ P208), N218 (≠ T213), T239 (= T234), A240 (= A235), R241 (= R236), D265 (= D259), H290 (= H283)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
33% identity, 83% coverage: 48:310/317 of query aligns to 49:317/331 of 1hkuA
- active site: S99 (≠ G98), R241 (= R236), D265 (= D259), E270 (= E264), H290 (= H283)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ T74), T103 (≠ V102), G156 (= G154), G158 (= G156), R159 (≠ D157), V160 (≠ I158), Y178 (≠ N176), D179 (≠ T177), P180 (≠ R178), Y181 (≠ T179), C212 (= C207), N218 (≠ T213), T239 (= T234), A240 (= A235), R241 (= R236), H290 (= H283), W293 (= W286)
Sites not aligning to the query:
6cdfA Human ctbp1 (28-378) (see paper)
34% identity, 83% coverage: 48:310/317 of query aligns to 50:318/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ V102), G157 (= G154), R160 (≠ D157), V161 (≠ I158), Y179 (≠ N176), D180 (vs. gap), P181 (vs. gap), Y182 (vs. gap), H212 (= H206), C213 (= C207), N219 (≠ T213), T240 (= T234), A241 (= A235), R242 (= R236), H291 (= H283), W294 (= W286)
Q9Z2F5 C-terminal-binding protein 1; CtBP1; 50 kDa BFA-dependent ADP-ribosylation substrate; BARS-50; C-terminal-binding protein 3; CtBP3; EC 1.1.1.- from Rattus norvegicus (Rat) (see 3 papers)
34% identity, 81% coverage: 55:310/317 of query aligns to 70:331/430 of Q9Z2F5
- S89 (≠ T74) binding
- IGLGRV 169:174 (≠ IGYGDI 153:158) binding
- G172 (= G156) mutation to E: Loss dimerization and of NAD binding.
- D193 (≠ T177) binding
- 226:232 (vs. 207:213, 29% identical) binding
- TAR 253:255 (= TAR 234:236) binding
- D279 (= D259) binding
Sites not aligning to the query:
- 41 A→E: Strongly reduces interaction with E1A.
- 55 V→R: Strongly reduces interaction with E1A.
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
33% identity, 80% coverage: 56:310/317 of query aligns to 56:304/311 of 3bazA
- active site: L98 (≠ G98), R230 (= R236), A251 (= A256), D254 (= D259), E259 (= E264), H277 (= H283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ T74), G149 (= G154), L150 (≠ Y155), G151 (= G156), R152 (≠ D157), I153 (= I158), S172 (≠ T177), R173 (= R178), S174 (≠ T179), C201 (= C207), P202 (= P208), T207 (= T213), I228 (≠ T234), G229 (≠ A235), R230 (= R236), D254 (= D259), H277 (= H283), G279 (≠ A285)
Query Sequence
>7026059 FitnessBrowser__ANA3:7026059
MKIVVLDGETLNPGDLTWQAVSALGEFSCFARTPSAEIIPRAQHAEIVLTNKTPLDANTL
AQLPKLKYIGVLATGTNVVDLAAAKELGIVVTNVPAYGPDAVAQMVFAHILHHTQAVAAH
HQAVAAGQWSNCSDFCFTLMPLQSLKGKTLGLIGYGDIGQQVAKLALAFGMKVLVNTRTQ
PRDLPQGVSWTSRDTVFKESDILSLHCPLTPETTELINAQTLELMKPQALLINTARGGLI
DEAALATALRQGKVFAGVDVLSTEPPSADNPLLTAPNISISPHNAWATKEARQNLLNIAT
ANLSAYLAGERVNWVNP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory