SitesBLAST
Comparing 7026220 FitnessBrowser__ANA3:7026220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
45% identity, 91% coverage: 12:412/440 of query aligns to 3:420/425 of O59010
- S65 (= S68) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S273) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 273:275) binding
- M311 (= M309) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T312) binding
- V355 (= V353) binding
- D394 (= D386) binding
- M395 (= M387) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R389) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N393) binding
- D405 (= D397) mutation to N: Strongly decreased affinity for aspartate.
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
47% identity, 91% coverage: 14:412/440 of query aligns to 1:418/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
47% identity, 91% coverage: 14:412/440 of query aligns to 3:420/427 of 5e9sA
- binding aspartic acid: R274 (≠ S273), S275 (= S274), S276 (= S275), T313 (= T312), G353 (= G352), V354 (= V353), A357 (= A356), G358 (= G357), D394 (= D386), R397 (= R389), T398 (= T390)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K192), G198 (≠ M196), Y202 (≠ L200)
- binding sodium ion: Y87 (= Y93), T90 (= T96), S91 (≠ T97), S276 (= S275), G305 (= G304), A306 (≠ T305), T307 (= T306), N309 (= N308), N309 (= N308), M310 (= M309), D311 (= D310), S348 (= S347), I349 (= I348), G350 (= G349), T351 (= T350), N401 (= N393), V402 (= V394), D405 (= D397)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
47% identity, 91% coverage: 14:412/440 of query aligns to 3:420/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
47% identity, 90% coverage: 15:412/440 of query aligns to 1:417/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L3 (≠ M17), L191 (≠ K192), G195 (≠ M196), R282 (≠ K284)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S273), S272 (= S274), S273 (= S275), M307 (= M309), T310 (= T312), G353 (= G355), A354 (= A356), R394 (= R389), T395 (= T390)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
48% identity, 89% coverage: 20:412/440 of query aligns to 2:409/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S273), S265 (= S275), M299 (= M309), T302 (= T312), T340 (= T350), G342 (= G352), V343 (= V353), G347 (= G357), D383 (= D386), R386 (= R389), T387 (= T390), N390 (= N393)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E41), V212 (≠ L221), A216 (≠ I225)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
45% identity, 91% coverage: 12:411/440 of query aligns to 3:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ W13), Y7 (≠ W16), F46 (≠ I49), F46 (≠ I49), P75 (≠ D78), L91 (≠ C95), F95 (≠ I99), L130 (≠ V134), I133 (≠ T137), I159 (≠ V163), Y167 (≠ L171), K196 (= K192), G200 (≠ M196), I207 (≠ Y203), F210 (= F206), L250 (≠ V246), I262 (≠ F259), M269 (= M266), T334 (= T332), V335 (≠ W333), G336 (≠ V334), T340 (= T338), L343 (= L341), M399 (≠ V391)
- binding aspartic acid: S277 (= S274), S278 (= S275), T314 (= T312), G354 (= G352), A358 (= A356), G359 (= G357), D394 (= D386), R397 (= R389), T398 (= T390)
- binding sodium ion: Y89 (= Y93), T92 (= T96), S93 (≠ T97), G306 (= G304), T308 (= T306), N310 (= N308), N310 (= N308), M311 (= M309), D312 (= D310), S349 (= S347), I350 (= I348), T352 (= T350), N401 (= N393), V402 (= V394), D405 (= D397)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
45% identity, 90% coverage: 13:408/440 of query aligns to 1:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ W16), G66 (= G72), V83 (≠ F90), I157 (≠ A164), Y164 (≠ L171), K193 (= K192), T305 (= T306), I306 (= I307), I347 (= I348)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I25), M199 (= M198), S275 (= S275), T311 (= T312), G356 (= G357), L384 (≠ A379), D391 (= D386), R394 (= R389)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
46% identity, 88% coverage: 20:408/440 of query aligns to 2:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
46% identity, 88% coverage: 20:408/440 of query aligns to 3:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
46% identity, 88% coverage: 20:408/440 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S275), M303 (= M309), T306 (= T312), A345 (= A351), G346 (= G352), V347 (= V353), G351 (= G357), D386 (= D386), C389 (≠ R389), T390 (= T390), N393 (= N393)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
43% identity, 88% coverage: 20:408/440 of query aligns to 3:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
37% identity, 85% coverage: 41:415/440 of query aligns to 48:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ K81), G89 (= G83), G92 (= G86), A95 (≠ S89), V96 (≠ F90), Y99 (= Y93), M163 (≠ V163), F167 (≠ I167), F293 (= F299), V297 (≠ L303)
- binding aspartic acid: S268 (= S274), S269 (= S275), T306 (= T312), G346 (= G352), I347 (≠ V353), A350 (= A356), G351 (= G357), D380 (= D386), R383 (= R389), T384 (= T390)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
37% identity, 85% coverage: 41:415/440 of query aligns to 40:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V73), S80 (≠ K81), G81 (= G83), G84 (= G86), Y91 (= Y93), M156 (≠ V163), F160 (≠ I167), F286 (= F299), V290 (≠ L303)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V65), I148 (= I155), S262 (= S275), S263 (≠ A276), A292 (≠ T305), T293 (= T306), M296 (= M309), T299 (= T312), G329 (= G349), A336 (= A356), G337 (= G357), D366 (= D386), R369 (= R389), N373 (= N393)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
34% identity, 98% coverage: 11:440/440 of query aligns to 10:493/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ S152) modified: carbohydrate, N-linked (GlcNAc...) asparagine
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
32% identity, 96% coverage: 11:432/440 of query aligns to 34:516/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
32% identity, 89% coverage: 50:439/440 of query aligns to 82:534/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
33% identity, 83% coverage: 50:415/440 of query aligns to 82:507/573 of P31596
- K298 (vs. gap) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (= H238) mutation H->N,T,K,R: No transporter activity.
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
32% identity, 90% coverage: 42:437/440 of query aligns to 71:521/532 of P43007
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ Q154) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (= E188) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ M387) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
37% identity, 83% coverage: 50:412/440 of query aligns to 46:420/425 of 7xr4A
Query Sequence
>7026220 FitnessBrowser__ANA3:7026220
MSKQRSSALGRIWSSWMSVPLWLQIFVGMVLGIAVGVSLGEQASYLKPIGTLFVNTIKML
IVPLVFCSLIVGVTSMEDTAKMGRIGFKSFAFYLCTTAIAISLGLAVGYVVQPGAGVPLL
QHEAVQTAKEVPSVMQTLIDIVPTNPVAALASGQILQVIVFAVALGIALVLIGDHGKPAI
KVFESLAEAMYKLTDMVMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYIGCIIHVL
GFYSIVLRLFAKLNPLHFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFV
LPLGTTINMDGTALYQGVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVM
LTLVLSTVGLPLEGVALIAGIDRILDMARTVVNVSGDLVATTVIAKSEDELDVEHYNADM
VQSAMIAEQNAASESAATKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory