SitesBLAST
Comparing 7026304 FitnessBrowser__ANA3:7026304 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3a52A Crystal structure of cold-active alkailne phosphatase from psychrophile shewanella sp. (see paper)
69% identity, 85% coverage: 43:438/464 of query aligns to 3:398/400 of 3a52A
- active site: D9 (= D49), S58 (= S98), H109 (= H149), T111 (= T151), R122 (= R162), E222 (= E262), D227 (= D267), W228 (= W268), H231 (= H271), D269 (= D309), H270 (= H310), H362 (= H402)
- binding magnesium ion: H109 (= H149), T111 (= T151), E222 (= E262), S276 (= S316), I277 (= I317), T363 (= T403), V365 (≠ T405)
- binding zinc ion: D227 (= D267), H231 (= H271), H362 (= H402)
3wbhA Structural characteristics of alkaline phosphatase from a moderately halophilic bacteria halomonas sp.593 (see paper)
34% identity, 60% coverage: 41:317/464 of query aligns to 3:318/497 of 3wbhA
- active site: D11 (= D49), S64 (= S98), H115 (= H149), T117 (= T151), R128 (= R162), E263 (= E262), D268 (= D267), W269 (= W268), H272 (= H271), D310 (= D309), H311 (= H310)
- binding magnesium ion: D11 (= D49), A44 (vs. gap), K45 (vs. gap), G47 (vs. gap), G102 (= G136), T117 (= T151), D254 (≠ N253), D256 (≠ Q255), E263 (= E262)
- binding zinc ion: D11 (= D49), S64 (= S98), D268 (= D267), H272 (= H271), D310 (= D309), H311 (= H310)
Sites not aligning to the query:
7kwdA Crystal structure of thermus thermophilus alkaline phosphatase (see paper)
31% identity, 84% coverage: 39:428/464 of query aligns to 21:444/473 of 7kwdA
- active site: D31 (= D49), S79 (= S98), H130 (= H149), T132 (= T151), R143 (= R162), E254 (= E262), D259 (= D267), H260 (≠ W268), H263 (= H271), D301 (= D309), H302 (= H310), H417 (= H402)
- binding magnesium ion: D31 (= D49), T132 (= T151), E254 (= E262)
- binding zinc ion: D31 (= D49), S79 (= S98), D259 (= D267), H263 (= H271), D301 (= D309), H302 (= H310), H417 (= H402)
7qowB Crystal structure of vibrio alkaline phosphatase in 1.0 m nacl (see paper)
33% identity, 61% coverage: 41:322/464 of query aligns to 4:328/505 of 7qowB
- binding chloride ion: R129 (= R162)
- binding magnesium ion: D12 (= D49), A45 (vs. gap), Q46 (vs. gap), G48 (vs. gap), T118 (= T151), E268 (= E262)
- binding phosphate ion: S65 (= S98), R129 (= R162), D273 (= D267)
- binding zinc ion: D12 (= D49), S65 (= S98), D273 (= D267), H277 (= H271), D315 (= D309), H316 (= H310)
Sites not aligning to the query:
2iucA Structure of alkaline phosphatase from the antarctic bacterium tab5 (see paper)
34% identity, 61% coverage: 40:322/464 of query aligns to 3:283/340 of 2iucA
- active site: D12 (= D49), S53 (= S98), H104 (= H149), T106 (= T151), R117 (= R162), E223 (= E262), D228 (= D267), W229 (= W268), H232 (= H271), D270 (= D309), H271 (= H310)
- binding magnesium ion: D12 (= D49), T106 (= T151), H113 (= H158), E122 (≠ A167), D126 (≠ S171), E223 (= E262), N235 (≠ D274), S237 (≠ A276)
- binding phosphate ion: S53 (= S98), R117 (= R162)
- binding zinc ion: D12 (= D49), S53 (= S98), D228 (= D267), H232 (= H271), D270 (= D309), H271 (= H310)
Sites not aligning to the query:
5c66A E. Coli alkaline phosphatase in complex with tungstate (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 35:362/441 of 5c66A
- active site: D43 (= D49), S94 (= S98), D145 (≠ H149), T147 (= T151), R158 (= R162), E314 (= E262), D319 (= D267), K320 (≠ W268), H323 (= H271), D361 (= D309), H362 (= H310)
- binding tungstate(vi)ion: D43 (= D49), D93 (= D97), S94 (= S98), R158 (= R162), D319 (= D267), H323 (= H271), H362 (= H310)
- binding zinc ion: D43 (= D49), D43 (= D49), S94 (= S98), T147 (= T151), E314 (= E262), D319 (= D267), H323 (= H271), D361 (= D309), H362 (= H310)
Sites not aligning to the query:
1y6vA Structure of e. Coli alkaline phosphatase in presence of cobalt at 1.60 a resolution (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 43:370/449 of 1y6vA
- active site: D51 (= D49), S102 (= S98), D153 (≠ H149), T155 (= T151), R166 (= R162), E322 (= E262), D327 (= D267), K328 (≠ W268), H331 (= H271), D369 (= D309), H370 (= H310)
- binding cobalt (ii) ion: D51 (= D49), D51 (= D49), S102 (= S98), T155 (= T151), E322 (= E262), D327 (= D267), D327 (= D267), H331 (= H271), D369 (= D309), H370 (= H310)
- binding phosphate ion: D101 (= D97), S102 (= S98), R166 (= R162), D327 (= D267), H370 (= H310)
Sites not aligning to the query:
1ew9A Alkaline phosphatase (E.C. 3.1.3.1) complex with mercaptomethyl phosphonate (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 43:370/449 of 1ew9A
- active site: D51 (= D49), S102 (= S98), D153 (≠ H149), T155 (= T151), R166 (= R162), E322 (= E262), D327 (= D267), K328 (≠ W268), H331 (= H271), D369 (= D309), H370 (= H310)
- binding magnesium ion: D51 (= D49), T155 (= T151), E322 (= E262)
- binding mercaptomethyl phosphonate: S102 (= S98), R166 (= R162), D327 (= D267), H331 (= H271)
- binding zinc ion: D51 (= D49), D51 (= D49), S102 (= S98), T155 (= T151), E322 (= E262), D327 (= D267), H331 (= H271), D369 (= D309), H370 (= H310)
Sites not aligning to the query:
1ew8A Alkaline phosphatase (E.C. 3.1.3.1) complex with phosphonoacetic acid (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 43:370/449 of 1ew8A
- active site: D51 (= D49), S102 (= S98), D153 (≠ H149), T155 (= T151), R166 (= R162), E322 (= E262), D327 (= D267), K328 (≠ W268), H331 (= H271), D369 (= D309), H370 (= H310)
- binding magnesium ion: D51 (= D49), T155 (= T151), E322 (= E262)
- binding phosphonoacetic acid: D51 (= D49), D101 (= D97), S102 (= S98), R166 (= R162), D327 (= D267)
- binding phosphate ion: D51 (= D49), S102 (= S98), R166 (= R162), D327 (= D267)
- binding zinc ion: D51 (= D49), D51 (= D49), T155 (= T151), E322 (= E262), D327 (= D267), H331 (= H271), D369 (= D309), H370 (= H310)
Sites not aligning to the query:
1ajbA Three-dimensional structure of the d153g mutant of e. Coli alkaline phosphatase: a mutant with weaker magnesium binding and increased catalytic activity (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 43:370/449 of 1ajbA
- active site: D51 (= D49), S102 (= S98), G153 (≠ H149), T155 (= T151), R166 (= R162), E322 (= E262), D327 (= D267), K328 (≠ W268), H331 (= H271), D369 (= D309), H370 (= H310)
- binding magnesium ion: D51 (= D49), T155 (= T151), E322 (= E262)
- binding zinc ion: D51 (= D49), S102 (= S98), D327 (= D267), H331 (= H271), D369 (= D309), H370 (= H310)
Sites not aligning to the query:
1kh5A E. Coli alkaline phosphatase mutant (d330n) mimic of the transition states with aluminium fluoride (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 38:365/444 of 1kh5A
Sites not aligning to the query:
1alhA Kinetics and crystal structure of a mutant e. Coli alkaline phosphatase (asp-369-->asn): a mechanism involving one zinc per active site (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 40:367/446 of 1alhA
- active site: D48 (= D49), S99 (= S98), D150 (≠ H149), T152 (= T151), R163 (= R162), E319 (= E262), D324 (= D267), K325 (≠ W268), H328 (= H271), N366 (≠ D309), H367 (= H310)
- binding phosphate ion: S99 (= S98), R163 (= R162), H328 (= H271)
- binding zinc ion: D324 (= D267), H328 (= H271)
Sites not aligning to the query:
2x98A H.Salinarum alkaline phosphatase (see paper)
35% identity, 83% coverage: 42:426/464 of query aligns to 6:416/430 of 2x98A
- active site: D13 (= D49), S72 (= S98), H127 (= H149), T129 (= T151), R140 (= R162), E256 (= E262), D261 (= D267), H262 (≠ W268), H265 (= H271), D303 (= D309), H304 (= H310), H392 (= H402)
- binding magnesium ion: D13 (= D49), Y115 (≠ L137), T129 (= T151), D239 (≠ S248), S242 (= S251), D248 (≠ E254), E256 (= E262), E318 (≠ N324), E320 (≠ N326)
- binding phosphate ion: D71 (= D97), S72 (= S98), R140 (= R162), D261 (= D267), H304 (= H310), H392 (= H402)
- binding zinc ion: D13 (= D49), D261 (= D267), H265 (= H271), D303 (= D309), H304 (= H310), H392 (= H402)
Sites not aligning to the query:
3dpcB Structure of e.Coli alkaline phosphatase mutant in complex with a phosphorylated peptide (see paper)
35% identity, 58% coverage: 41:310/464 of query aligns to 42:369/448 of 3dpcB
- active site: D50 (= D49), L101 (≠ S98), D152 (≠ H149), T154 (= T151), R165 (= R162), E321 (= E262), D326 (= D267), K327 (≠ W268), H330 (= H271), D368 (= D309), H369 (= H310)
- binding : L101 (≠ S98), Y115 (= Y112), N116 (= N113), G117 (= G114), R165 (= R162), K166 (= K163)
Sites not aligning to the query:
2w5vA Structure of tab5 alkaline phosphatase mutant his 135 asp with mg bound in the m3 site. (see paper)
34% identity, 61% coverage: 40:322/464 of query aligns to 5:285/346 of 2w5vA
- active site: D14 (= D49), S55 (= S98), D106 (≠ H149), T108 (= T151), R119 (= R162), E225 (= E262), D230 (= D267), W231 (= W268), H234 (= H271), D272 (= D309), H273 (= H310)
- binding magnesium ion: D14 (= D49), T108 (= T151), E225 (= E262), N237 (≠ D274), S239 (≠ A276)
- binding zinc ion: D14 (= D49), S55 (= S98), S55 (= S98), D230 (= D267), H234 (= H271), D272 (= D309), H273 (= H310)
Sites not aligning to the query:
7tm9A Crystal structure of bacterial alkaline phosphatase from klebsiella pneumoniae
35% identity, 60% coverage: 41:320/464 of query aligns to 35:372/441 of 7tm9A
Sites not aligning to the query:
Q02QC9 Alkaline phosphatase H; High molecular weight phosphatase; H-AP; EC 3.1.3.1 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see 2 papers)
33% identity, 59% coverage: 39:310/464 of query aligns to 67:396/476 of Q02QC9
- S128 (= S98) active site, Phosphoserine intermediate; modified: Phosphoserine
- S206 (vs. gap) modified: Phosphoserine
P09242 Alkaline phosphatase, tissue-nonspecific isozyme; AP-TNAP; TNAP; TNSALP; Alkaline phosphatase 2; Alkaline phosphatase liver/bone/kidney isozyme; Phosphoamidase; Phosphocreatine phosphatase; EC 3.1.3.1; EC 3.9.1.1 from Mus musculus (Mouse) (see paper)
29% identity, 83% coverage: 41:425/464 of query aligns to 52:478/524 of P09242
- N140 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N230 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N303 (≠ D235) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N430 (≠ E366) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P83456 Alkaline phosphatase; AP; EC 3.1.3.1 from Gadus morhua (Atlantic cod) (see paper)
28% identity, 84% coverage: 38:425/464 of query aligns to 33:461/477 of P83456
- N124 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C165 (≠ N159) modified: Disulfide link with 185
- C185 (vs. gap) modified: Disulfide link with 165
- N214 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N413 (≠ E366) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P05187 Alkaline phosphatase, placental type; Alkaline phosphatase Regan isozyme; Placental alkaline phosphatase 1; PLAP-1; EC 3.1.3.1 from Homo sapiens (Human) (see 11 papers)
28% identity, 90% coverage: 41:459/464 of query aligns to 56:500/535 of P05187
- D64 (= D49) binding ; binding
- I89 (≠ T74) to L: in dbSNP:rs13026692
- S114 (= S98) binding
- C143 (vs. gap) modified: Disulfide link with 205
- N144 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- S177 (≠ T151) binding
- C205 (vs. gap) modified: Disulfide link with 143
- R231 (vs. gap) to P: in dbSNP:rs1048988
- R263 (vs. gap) to H: in dbSNP:rs2853378
- N271 (≠ T205) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E333 (= E262) binding
- D338 (= D267) binding
- H342 (= H271) binding
- D379 (= D309) binding
- H380 (= H310) binding
- H454 (= H402) binding
- C489 (≠ V448) modified: Disulfide link with 496
- C496 (≠ P455) modified: Disulfide link with 489
Sites not aligning to the query:
- 1:22 signal peptide
- 25 P → L: in dbSNP:rs1130335
- 506 modified: GPI-anchor amidated aspartate
Query Sequence
>7026304 FitnessBrowser__ANA3:7026304
MSFTKAPLLLLGMSLWLSNSALAVEAGANETGPVKAPSRPKNIVIMIGDGMGPSYTSAYR
YYKDNPDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDT
QKQPLPTIFEKAKTLGLSTGVAVTSQINHATPAAFLSHNESRKNYDALALSYLETNADVF
LGGGQKYFPPELLAQFTAKGYQHITRFDDLASITQPKVLGLFAEVQLPWAIDEKDAKKLS
TLTQKALSLLSQNEQGFVLLVEGSLIDWAGHNNDIAAAMGEMDEFANAIEVVEQFVRQNP
DTLMVITADHNTGGLSIGADGNYNWNPEILRNISASSDTLAQAALGGDTWQADLSRGLGF
ELTEEEVTKLNVARMQGLETMAVAIRHVIDKRTDTGWTTGGHTGTDVQVFAAGPASELFN
GHQDNTDIANKIFSLLPKPKKPKATAQVSTPAPAPELAPVQSQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory