Comparing 7026323 FitnessBrowser__ANA3:7026323 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
54% identity, 96% coverage: 15:368/370 of query aligns to 8:366/369 of 3h7cX
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
53% identity, 96% coverage: 15:368/370 of query aligns to 8:373/383 of Q8GWW7
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
50% identity, 97% coverage: 10:368/370 of query aligns to 3:373/374 of G7JT50
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
51% identity, 95% coverage: 19:368/370 of query aligns to 2:359/360 of 6nicD
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
46% identity, 96% coverage: 13:368/370 of query aligns to 8:364/365 of Q837U5
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
29% identity, 93% coverage: 25:369/370 of query aligns to 15:331/333 of 6b2wA
>7026323 FitnessBrowser__ANA3:7026323
MTNANVDATQLTTKPSEDGFYMPAEWAAQQAVWMIWPYRPDNWRSAGAYAQATFAKVADA
IGGATPVYMGVPQAFLAEAQTVMPSHVTLVEIDSNDCWARDTGPTVVVNAEGECRGVDWG
FNAWGGHNGGLYFPWDKDEQVAAQMLKQHGFARYSAPLILEGGSIHVDGEGTCMTTAECL
LNANRNPDLTKEQIEALLRDYLNVKQFIWLEEGVYMDETDGHIDNMCCFARPGEVILHWT
DDETDPQYPRSKAALDVLQNTVDAQGRKLKIHLLPQPGPLYCTEEESKGVTEGTGVPRTA
GERLAGSYVNFLITNDRIVFPLLDPATDDIAAQKLQEIFPEHKIVGVPAREILLGGGNIH
CITQQIPSGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory