SitesBLAST
Comparing 7026373 FitnessBrowser__ANA3:7026373 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 89% coverage: 1:312/349 of query aligns to 14:334/378 of P69874
- C26 (≠ D13) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y14) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I32) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C41) mutation to T: Loss of ATPase activity and transport.
- L60 (= L47) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I63) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V124) mutation to M: Loss of ATPase activity and transport.
- D172 (= D161) mutation to N: Loss of ATPase activity and transport.
- C276 (≠ L263) mutation to A: Lower ATPase activity and transport efficiency.
- E297 (≠ Q281) mutation E->K,D: Lower ATPase activity and transport efficiency.; mutation to Q: Loss of ATPase activity and transport.
1g291 Malk (see paper)
43% identity, 69% coverage: 20:261/349 of query aligns to 19:264/372 of 1g291
- binding magnesium ion: D69 (≠ G70), E71 (vs. gap), K72 (≠ A71), K79 (≠ E78), D80 (≠ Q79)
- binding pyrophosphate 2-: S38 (= S39), G39 (= G40), C40 (= C41), G41 (= G42), K42 (= K43), T43 (= T44), T44 (= T45)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
42% identity, 66% coverage: 20:249/349 of query aligns to 22:257/375 of 2d62A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 77% coverage: 20:288/349 of query aligns to 21:286/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 77% coverage: 20:288/349 of query aligns to 21:286/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
39% identity, 77% coverage: 20:288/349 of query aligns to 21:286/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
39% identity, 77% coverage: 20:288/349 of query aligns to 21:286/353 of Q97UY8
- S142 (= S138) mutation to A: Decrease in ATPase activity. Can form dimers.
- G144 (= G140) mutation to A: Loss of ATPase activity. Cannot form dimers. Forms an active heterodimer; when associated with A-166.
- E166 (= E162) mutation to A: Loss of ATPase activity. Can form dimers in the presence of ATP-Mg(2+). Forms an active heterodimer; when associated with A-144.; mutation to Q: Strong decrease in ATPase activity. Can form dimers in the presence of ATP alone, without Mg(2+).
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
41% identity, 70% coverage: 3:247/349 of query aligns to 1:245/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y14), S37 (= S39), G38 (= G40), C39 (= C41), G40 (= G42), K41 (= K43), S42 (≠ T44), T43 (= T45), Q81 (= Q87), R128 (= R132), A132 (≠ E136), S134 (= S138), G136 (= G140), Q137 (= Q141), E158 (= E162), H191 (= H195)
- binding magnesium ion: S42 (≠ T44), Q81 (= Q87)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
41% identity, 70% coverage: 3:247/349 of query aligns to 1:245/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y14), G38 (= G40), C39 (= C41), G40 (= G42), K41 (= K43), S42 (≠ T44), T43 (= T45), R128 (= R132), S134 (= S138), Q137 (= Q141)
- binding beryllium trifluoride ion: S37 (= S39), G38 (= G40), K41 (= K43), Q81 (= Q87), S134 (= S138), G136 (= G140), H191 (= H195)
- binding magnesium ion: S42 (≠ T44), Q81 (= Q87)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
41% identity, 70% coverage: 3:247/349 of query aligns to 1:245/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y14), V17 (= V19), G38 (= G40), C39 (= C41), G40 (= G42), K41 (= K43), S42 (≠ T44), T43 (= T45), R128 (= R132), A132 (≠ E136), S134 (= S138), Q137 (= Q141)
- binding tetrafluoroaluminate ion: S37 (= S39), G38 (= G40), K41 (= K43), Q81 (= Q87), S134 (= S138), G135 (= G139), G136 (= G140), E158 (= E162), H191 (= H195)
- binding magnesium ion: S42 (≠ T44), Q81 (= Q87)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
41% identity, 70% coverage: 3:247/349 of query aligns to 1:245/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y14), V17 (= V19), G38 (= G40), C39 (= C41), G40 (= G42), K41 (= K43), S42 (≠ T44), T43 (= T45), R128 (= R132), A132 (≠ E136), S134 (= S138), Q137 (= Q141)
- binding magnesium ion: S42 (≠ T44), Q81 (= Q87)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
41% identity, 70% coverage: 3:247/349 of query aligns to 1:245/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
41% identity, 70% coverage: 3:247/349 of query aligns to 2:246/371 of P68187
- A85 (= A90) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ Q112) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L117) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ M120) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A122) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ E127) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G140) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D161) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R231) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- F241 (≠ Y242) mutation to I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 70% coverage: 3:247/349 of query aligns to 2:246/369 of P19566
- L86 (= L91) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P163) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D168) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
43% identity, 66% coverage: 19:247/349 of query aligns to 15:243/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S39), G36 (= G40), C37 (= C41), G38 (= G42), K39 (= K43), S40 (≠ T44), T41 (= T45), R126 (= R132), A130 (≠ E136), S132 (= S138), G134 (= G140), Q135 (= Q141)
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
37% identity, 99% coverage: 2:346/349 of query aligns to 1:329/350 of 3fvqB
- binding adenosine-5'-triphosphate: F13 (≠ Y14), Q14 (= Q15), T16 (≠ Q17), V18 (= V19), S38 (= S39), G39 (= G40), C40 (= C41), G41 (= G42), K42 (= K43), T43 (= T44), T44 (= T45), R133 (= R132), E137 (= E136), S139 (= S138), G141 (= G140), Q142 (= Q141)
- binding calcium ion: T43 (= T44), Q86 (= Q87)
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
42% identity, 66% coverage: 23:251/349 of query aligns to 25:245/353 of 1vciA
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 75% coverage: 7:268/349 of query aligns to 6:266/393 of P9WQI3
- H193 (= H195) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hplC Lpqy-sugabc in state 1 (see paper)
36% identity, 91% coverage: 7:322/349 of query aligns to 5:334/384 of 8hplC
8hprD Lpqy-sugabc in state 4 (see paper)
34% identity, 98% coverage: 7:349/349 of query aligns to 5:353/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y14), S38 (= S39), C40 (= C41), G41 (= G42), K42 (= K43), S43 (≠ T44), T44 (= T45), Q82 (= Q87), R129 (= R132), Q133 (≠ E136), S135 (= S138), G136 (= G139), G137 (= G140), Q159 (≠ E162), H192 (= H195)
- binding magnesium ion: S43 (≠ T44), Q82 (= Q87)
Query Sequence
>7026373 FitnessBrowser__ANA3:7026373
MTSTLNLHQVHSDYQGQQVLKGLDLTLAQGEILALLGPSGCGKTTLLRAVAGLQAISQGE
IQINGKTVSGAGQFVPSEQRGIGMIFQDYALFPHLTVAENILFGVAKLTPAQRKARLDDM
LALVKLEGLAKRYPHELSGGQQQRVSIARALAYEPQLLLLDEPFSNIDAQVRHSMMAEIR
SILKQRNVSAVFVTHSKDEAFVFADTLAIFNQGVIVQHGRAENLYAAPNSRYVADFLGSG
NYLPAEVIDGHSVVTPIGELRSLTPLSQSHAFNGQVFLRPQQLALSADDAGVGTITERRF
LGAFCHYWVKVEAASHAHYVEVRSQIMQLNVGQRVVLSTEPHALVLFES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory