Comparing 7026580 FitnessBrowser__ANA3:7026580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
2yjvC Crystal structure of e. Coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb (see paper)
66% identity, 98% coverage: 2:159/161 of query aligns to 1:158/158 of 2yjvC
1nxjA Structure of rv3853 from mycobacterium tuberculosis (see paper)
45% identity, 87% coverage: 14:153/161 of query aligns to 9:155/156 of 1nxjA
>7026580 FitnessBrowser__ANA3:7026580
MEYNTSELCDMYLDVVDVVEPMFSNYGGCSSFGGSISTIKCFEDNGLITEVLQEDGQGKV
LLVDGGGSLRRALIDASIAEIAVNNNWEGIIVYGSVRDVDALEELDIGIQALASIPVGAD
GNSVGEVEIPVNFGGVTFLPGDHIYADNTGIILSPEPLDIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory