Comparing 7026581 FitnessBrowser__ANA3:7026581 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
27% identity, 45% coverage: 50:205/350 of query aligns to 23:156/293 of 3pzlB
Sites not aligning to the query:
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
27% identity, 54% coverage: 125:313/350 of query aligns to 69:261/299 of 1cevA
Sites not aligning to the query:
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
27% identity, 54% coverage: 125:313/350 of query aligns to 69:261/299 of P53608
Sites not aligning to the query:
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
27% identity, 54% coverage: 125:313/350 of query aligns to 68:260/298 of 5cevA
Sites not aligning to the query:
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
27% identity, 54% coverage: 125:313/350 of query aligns to 68:260/298 of 4cevA
Sites not aligning to the query:
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
27% identity, 54% coverage: 125:313/350 of query aligns to 68:260/298 of 3cevA
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
27% identity, 54% coverage: 125:313/350 of query aligns to 68:260/298 of 2cevB
Sites not aligning to the query:
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
28% identity, 45% coverage: 38:196/350 of query aligns to 6:154/298 of 4mynA
Sites not aligning to the query:
>7026581 FitnessBrowser__ANA3:7026581
MSEFIPFTQADVASLVSPRAGETKIGQCVHLANHEHPLEAILATAKAHGAQFAILGVGED
IGPRANLGRGGATDAFTTSMRQWLNLQSNRFLSGAECLILGQVHTADLQLQAQDGEGASL
PHLRQAVEQLDERVISIVSAIQAAGLEPIVIGGGHNNAYGLLMATSAHYQRQVAAVNLDP
HSDFRLLEGRHSGNGFSYAANRGALGYYHVLGLHELKNSEANLQQLSDFGGTWHSLQQIW
IRREVSLTEALQEIAGKLNHTALPVGLELDVDAIAKMPSSASTAAGIPLLDAAHYISYIA
SHCPCAYLHLAEAAPSCHEAGTEAGFRDVGQSISELIYAYVQARRHFLAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory