SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 7026625 Shewana3_3758 isopropylmalate isomerase small subunit (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 15 hits to proteins with known functional sites (download)

O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
47% identity, 95% coverage: 4:194/201 of query aligns to 540:725/758 of O14289

query
sites
O14289
F
 
F
T
 
T
S
 
V
H
 
V
T
 
E
G
 
G
L
 
I
A
 
A
V
 
A
M
 
P
I
 
L
D
 
P
S
 
M
A
 
A
N
 
N
I
 
V
D
 
D
T
 
T
D
 
D
Q
 
K
I
 
I
I
 
I
P
 
P
K
 
K
Q
 
Q
F
 
F
L
 
L
S
 
K
K
 
T
V
 
I
T
 
K
R
 
R
D
 
T
G
 
G
F
 
L
G
 
G
V
 
Q
H
 
F
L
 
A
F
 
F
H
 
Y
D
 
E
W
 
I
R
 
R
Y
 
Y
L
 
D
D
 
A
D
 
D
A
 
G
G
 
K
E
 
E
V
 
I
P
 
P
N
 
-
P
 
-
D
 
D
F
 
F
T
 
V
L
 
L
N
 
N
K
 
R
P
 
E
R
 
P
Y
 
Y
S
 
R
G
 
H
A
 
A
S
 
T
I
 
V
L
 
L
L
 
V
A
 
A
Q
 
H
E
 
D
N
 
N
F
 
F
G
 
G
C
 
C
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
H
 
H
A
 
A
P
 
P
W
 
W
A
 
A
L
 
L
A
 
N
D
 
D
F
 
F
G
 
G
L
 
I
R
 
R
A
 
V
I
 
I
I
 
I
A
 
A
P
 
P
S
 
S
F
 
F
A
 
A
D
 
D
I
 
I
F
 
F
Y
 
F
G
 
N
N
 
N
S
 
C
I
 
F
N
 
K
N
 
N
G
 
G
L
 
M
L
 
L
P
 
P
V
 
I
K
 
P
L
 
T
S
 
P
A
 
I
N
 
E
E
 
Q
V
 
V
R
 
N
Q
 
D
L
 
M
M
 
M
D
 
K
E
 
-
V
 
-
A
 
A
S
 
A
E
 
E
E
 
N
G
 
Q
A
 
V
Q
 
K
I
 
F
T
 
S
V
 
V
D
 
D
L
 
L
T
 
V
T
 
N
C
 
Q
K
 
T
V
 
I
T
 
T
S
 
Y
P
 
G
L
 
-
G
 
D
A
 
K
E
 
Q
F
 
V
S
 
K
F
 
F
T
 
D
L
 
V
A
 
E
E
 
P
S
 
F
A
 
R
R
 
K
H
 
H
K
 
C
L
 
L
L
 
V
N
 
N
G
 
G
L
 
L
D
 
D
A
 
D
I
 
I
G
 
G
L
 
L
T
 
T
L
 
L
S
 
Q
H
 
K
G
 
E
I
 
T
Q
 
M
I
 
I
G
 
D
E
 
A
Y
 
F
E
 
E
S
 
A

Sites not aligning to the query:

P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 100% coverage: 1:200/201 of query aligns to 1:191/198 of P9WK95

query
sites
P9WK95
M
 
M
Q
 
E
P
 
A
F
 
F
T
 
H
S
 
T
H
 
H
T
 
S
G
 
G
L
 
I
A
 
G
V
 
V
M
 
P
I
 
L
D
 
R
S
 
R
A
 
S
N
 
N
I
 
V
D
 
D
T
 
T
D
 
D
Q
 
Q
I
 
I
I
 
I
P
 
P
K
 
A
Q
 
V
F
 
F
L
 
L
S
 
K
K
 
R
V
 
V
T
 
T
R
 
R
D
 
T
G
 
G
F
 
F
G
 
E
V
 
D
H
 
G
L
 
L
F
 
F
H
 
A
D
 
G
W
 
W
R
 
R
Y
 
-
L
 
-
D
 
-
D
 
-
A
 
-
G
 
-
E
 
-
V
 
-
P
 
S
N
 
D
P
 
P
D
 
A
F
 
F
T
 
V
L
 
L
N
 
N
K
 
L
P
 
S
R
 
P
Y
 
F
S
 
D
G
 
R
A
 
G
S
 
S
I
 
V
L
 
L
L
 
V
A
 
A
Q
 
G
E
 
P
N
 
D
F
 
F
G
 
G
C
 
T
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
H
 
H
A
 
A
P
 
V
W
 
W
A
 
A
L
 
L
A
 
M
D
 
D
F
 
Y
G
 
G
L
 
F
R
 
R
A
 
V
I
 
V
I
 
I
A
 
S
P
 
S
S
 
R
F
 
F
A
 
G
D
 
D
I
 
I
F
 
F
Y
 
R
G
 
G
N
 
N
S
 
A
I
 
G
N
 
K
N
 
A
G
 
G
L
 
L
L
 
L
P
 
A
V
 
A
K
 
E
L
 
V
S
 
A
A
 
Q
N
 
D
E
 
D
V
 
V
R
 
E
Q
 
L
L
 
L
M
 
W
D
 
K
E
 
L
V
 
I
A
 
E
S
 
Q
E
 
S
E
 
P
G
 
G
A
 
L
Q
 
E
I
 
I
T
 
T
V
 
A
D
 
N
L
 
L
T
 
Q
T
 
D
C
 
-
K
 
R
V
 
I
T
 
I
S
 
T
P
 
A
L
 
A
G
 
T
A
 
V
E
 
V
F
 
L
S
 
P
F
 
F
T
x
K
L
 
I
A
 
D
E
 
D
S
 
H
A
 
S
R
 
A
H
 
W
K
 
R
L
 
L
L
 
L
N
 
E
G
 
G
L
 
L
D
 
D
A
 
D
I
 
I
G
 
A
L
 
L
T
 
T
L
 
L
S
 
R
H
 
K
G
 
L
I
 
D
Q
 
E
I
 
I
G
 
E
E
 
A
Y
 
F
E
 
E
S
 
G
Q
 
A
I
 
C
P
 
A
S
 
Y
W
 
W
R
 
K

Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
35% identity, 71% coverage: 18:159/201 of query aligns to 13:143/170 of Q58667

query
sites
Q58667
N
 
D
I
 
V
D
 
D
T
 
T
D
 
D
Q
 
A
I
 
I
I
 
I
P
 
P
K
 
G
Q
 
P
F
 
Y
L
 
L
S
x
R
K
 
-
V
 
-
T
|
T
R
 
T
D
 
D
G
 
P
F
 
Y
G
 
E
V
 
L
H
 
A
L
 
-
F
 
S
H
 
H
D
 
C
W
 
M
R
 
A
Y
 
G
L
 
I
D
 
D
D
 
E
A
 
-
G
 
-
E
 
-
V
 
-
P
 
-
N
 
-
P
 
-
D
 
-
F
 
-
T
 
-
L
 
-
N
 
N
K
 
F
P
 
P
R
 
K
-
 
K
Y
 
V
S
 
K
G
 
E
A
 
G
S
 
D
I
 
V
L
 
I
L
 
V
A
 
A
Q
 
G
E
 
E
N
 
N
F
 
F
G
 
G
C
 
C
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
H
 
Q
A
 
A
P
 
V
W
 
I
A
 
A
L
 
I
A
 
K
D
 
Y
F
 
C
G
 
G
L
 
I
R
 
K
A
 
A
I
 
V
I
 
I
A
 
A
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
F
Y
 
Y
G
 
R
N
 
N
S
 
A
I
 
I
N
 
N
N
 
V
G
 
G
L
 
L
L
 
I
P
 
P
V
 
I
K
 
I
L
 
A
S
 
N
A
 
T
N
 
D
E
 
E
V
 
I
R
 
K
-
 
D
-
 
G
Q
 
D
L
 
I
M
 
V
D
 
E
E
 
I
V
 
D
A
 
L
S
 
D
E
 
K
E
 
E
G
 
E
A
 
I
Q
 
V
I
 
I
T
 
T
V
 
N
D
 
K
L
 
N
T
 
K
T
 
T
C
 
I
K
 
K
V
 
C
T
 
E
S
 
T
P
 
P
L
 
K
G
 
G
A
 
L
E
 
E

2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud) from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
35% identity, 71% coverage: 18:159/201 of query aligns to 13:143/167 of 2pkpA

query
sites
2pkpA
N
x
D
I
 
V
D
 
D
T
 
T
D
 
D
Q
 
A
I
 
I
I
 
I
P
 
P
K
 
G
Q
 
P
F
 
Y
L
 
L
S
 
R
K
 
-
V
 
-
T
 
T
R
 
T
D
 
D
G
 
P
F
 
Y
G
 
E
V
 
L
H
 
A
L
 
-
F
 
S
H
 
H
D
 
C
W
 
M
R
 
A
Y
 
G
L
 
I
D
 
D
D
 
E
A
 
-
G
 
-
E
 
-
V
 
-
P
 
-
N
 
-
P
 
-
D
 
-
F
 
-
T
 
-
L
 
-
N
 
N
K
 
F
P
 
P
R
 
K
-
 
K
Y
 
V
S
 
K
G
 
E
A
 
G
S
 
D
I
 
V
L
 
I
L
 
V
A
 
A
Q
 
G
E
 
E
N
 
N
F
 
F
G
 
G
C
|
C
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
H
 
Q
A
 
A
P
 
V
W
 
I
A
 
A
L
 
I
A
 
K
D
 
Y
F
 
C
G
 
G
L
 
I
R
 
K
A
 
A
I
 
V
I
 
I
A
 
A
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
F
Y
 
Y
G
 
R
N
 
N
S
 
A
I
 
I
N
 
N
N
 
V
G
 
G
L
 
L
L
 
I
P
 
P
V
 
I
K
 
I
L
 
A
S
 
N
A
 
T
N
 
D
E
 
E
V
 
I
R
 
K
-
 
D
-
 
G
Q
 
D
L
 
I
M
 
V
D
 
E
E
 
I
V
 
D
A
 
L
S
 
D
E
 
K
E
 
E
G
 
E
A
 
I
Q
 
V
I
 
I
T
 
T
V
 
N
D
 
K
L
 
N
T
 
K
T
 
T
C
 
I
K
 
K
V
 
C
T
 
E
S
 
T
P
 
P
L
 
K
G
 
G
A
 
L
E
 
E

P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
39% identity, 34% coverage: 56:124/201 of query aligns to 642:710/780 of P20004

query
sites
P20004
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
K
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
 
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
A
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
H
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

5acnA Structure of activated aconitase. Formation of the (4fe-4s) cluster in the crystal (see paper)
38% identity, 34% coverage: 56:124/201 of query aligns to 615:683/754 of 5acnA

query
sites
5acnA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
|
S
S
 
S
R
|
R
E
 
E
H
 
H
A
 
S
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
H
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
x
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

P16276 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Sus scrofa (Pig) (see 3 papers)
38% identity, 34% coverage: 56:124/201 of query aligns to 642:710/781 of P16276

query
sites
P16276
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
 
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
R
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
H
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

1b0kA S642a:fluorocitrate complex of aconitase (see paper)
36% identity, 34% coverage: 56:124/201 of query aligns to 614:682/753 of 1b0kA

query
sites
1b0kA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
x
A
S
|
S
R
|
R
E
 
E
H
 
H
A
 
S
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
H
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

8acnA Crystal structures of aconitase with isocitrate and nitroisocitrate bound (see paper)
38% identity, 34% coverage: 56:124/201 of query aligns to 614:682/753 of 8acnA

query
sites
8acnA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
|
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
S
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
F
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

1fghA Complex with 4-hydroxy-trans-aconitate (see paper)
38% identity, 34% coverage: 56:124/201 of query aligns to 614:682/753 of 1fghA

query
sites
1fghA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
|
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
S
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
F
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

1amjA Steric and conformational features of the aconitase mechanism (see paper)
38% identity, 34% coverage: 56:124/201 of query aligns to 614:682/753 of 1amjA

query
sites
1amjA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
|
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
S
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
F
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

1amiA Steric and conformational features of the aconitase mechanism (see paper)
38% identity, 34% coverage: 56:124/201 of query aligns to 614:682/753 of 1amiA

query
sites
1amiA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
|
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
S
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
F
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

1acoA Crystal structure of aconitase with transaconitate bound (see paper)
38% identity, 34% coverage: 56:124/201 of query aligns to 614:682/753 of 1acoA

query
sites
1acoA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
|
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
S
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
F
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

1nisA Crystal structure of aconitase with trans-aconitate and nitrocitrate bound (see paper)
38% identity, 34% coverage: 56:124/201 of query aligns to 614:682/753 of 1nisA

query
sites
1nisA
P
 
P
N
 
V
P
 
P
D
 
D
F
 
T
T
 
A
L
 
R
N
 
Y
K
 
Y
P
 
K
R
 
Q
Y
 
H
S
 
G
G
 
I
A
 
R
S
 
W
I
 
V
L
 
V
L
 
I
A
 
G
Q
 
D
E
 
E
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
|
S
S
|
S
R
|
R
E
 
E
H
 
H
A
 
R
P
 
A
W
 
L
A
 
E
L
 
P
A
 
R
D
 
F
F
 
L
G
 
G
L
 
G
R
 
R
A
 
A
I
 
I
I
 
I
A
 
T
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
L
L
 
L
P
 
P
V
 
L
K
 
T
L
 
F
S
 
A

Sites not aligning to the query:

P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 50% coverage: 73:172/201 of query aligns to 661:765/789 of P39533

query
sites
P39533
L
 
V
L
 
I
A
 
A
Q
 
E
E
 
H
N
 
N
F
 
Y
G
 
G
C
 
E
G
 
G
S
 
S
S
 
A
R
 
R
E
 
E
H
 
H
A
 
A
P
 
A
W
 
L
A
 
S
L
 
P
A
 
R
D
 
F
F
 
L
G
 
G
L
 
G
R
 
E
A
 
I
I
 
L
I
 
L
A
 
V
P
 
K
S
 
S
F
 
F
A
 
A
D
 
R
I
 
I
F
 
H
Y
 
E
G
 
T
N
 
N
S
 
L
I
 
K
N
 
K
N
 
Q
G
 
G
L
 
V
L
 
L
P
 
P
V
 
L
-
 
T
-
 
F
-
 
A
-
 
N
-
 
E
-
 
S
-
 
D
-
 
Y
-
 
D
K
 
K
L
 
I
S
 
S
A
 
S
N
 
G
E
 
D
V
 
V
R
 
L
Q
 
E
-
 
T
-
 
L
-
 
N
L
 
L
M
 
V
D
 
D
E
 
M
V
 
I
A
 
A
S
 
K
E
 
D
-
 
G
-
 
N
E
 
N
G
 
G
A
 
G
Q
 
E
I
 
I
T
 
D
V
 
V
D
 
-
L
 
-
T
 
-
T
 
-
C
 
-
K
 
K
V
 
I
T
 
T
S
 
K
P
 
P
L
 
N
G
 
G
A
 
E
E
 
S
F
 
F
S
 
T
F
 
I
T
 
-
L
 
-
A
 
-
E
 
-
S
 
K
A
 
A
R
 
K
H
 
H
K
 
T
L
 
M

Sites not aligning to the query:

Query Sequence

>7026625 Shewana3_3758 isopropylmalate isomerase small subunit (RefSeq)
MQPFTSHTGLAVMIDSANIDTDQIIPKQFLSKVTRDGFGVHLFHDWRYLDDAGEVPNPDF
TLNKPRYSGASILLAQENFGCGSSREHAPWALADFGLRAIIAPSFADIFYGNSINNGLLP
VKLSANEVRQLMDEVASEEGAQITVDLTTCKVTSPLGAEFSFTLAESARHKLLNGLDAIG
LTLSHGIQIGEYESQIPSWRC

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory