Comparing 7026812 Shewana3_3941 carboxypeptidase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
39% identity, 85% coverage: 71:468/470 of query aligns to 9:377/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
36% identity, 85% coverage: 69:468/470 of query aligns to 13:389/389 of 4ewtA
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 92% coverage: 38:469/470 of query aligns to 7:428/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 89% coverage: 48:467/470 of query aligns to 29:427/442 of P54968
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
34% identity, 83% coverage: 70:459/470 of query aligns to 20:389/398 of 6slfA
7yh4A Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (pm20d2)
27% identity, 62% coverage: 167:459/470 of query aligns to 101:378/400 of 7yh4A
3ramA Crystal structure of hmra (see paper)
28% identity, 56% coverage: 67:327/470 of query aligns to 2:234/391 of 3ramA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
29% identity, 40% coverage: 197:386/470 of query aligns to 131:301/373 of 3rzaA
Sites not aligning to the query:
>7026812 Shewana3_3941 carboxypeptidase (RefSeq)
MTVSSVSRALSTSSVATSFVPYVSSLGVSPSRFTKSLIASALTLSLLGAGLSSANAAQPD
AAKLAAGVEQKVIDWRRDLHQHPELSNREFRTSKIIEKHLKSLGLEVQTGIAHTGVVAIL
KGGKLKGGKPGPLIAIRADMDALPVTEVVDVPFASKATDTYRGKTVGVMHACGHDTHVAM
LMGVAENLVKVKDSLAGDVMFIFQPAEEGAPDGEEGGAELMLKQGLFAKRKPDQVFGMHV
TSSMPSGMIGVRSGPAMASGDSFTIKVKGRQTHGSRPWNGVDPIVAAAQIITNVQTIVSR
QVDITKAPAVVSFGAVNGGIRSNIIPDEVELIGTIRTFDQPMRADIKVRLAEIAELSAKT
LGATATTEIHQGYPVVVNNPELVASMRPVLASVVGDKMLIEPGLITGAEDFSFYALESPG
MFFFLGVTPKGTDPETAASNHSPAFYVDESALKVGVEAMTKVALTALKAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory