SitesBLAST
Comparing 7026925 FitnessBrowser__ANA3:7026925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u1oB 2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad.
76% identity, 100% coverage: 1:451/451 of query aligns to 1:451/451 of 5u1oB
- active site: L38 (≠ V38), C42 (= C42), C47 (= C47), K50 (= K50), Y177 (= Y177), E181 (= E181), A438 (= A438), H440 (= H440), E445 (= E445)
- binding flavin-adenine dinucleotide: G13 (= G13), S14 (= S14), G15 (= G15), E34 (= E34), A35 (= A35), T41 (= T41), C42 (= C42), G46 (= G46), C47 (= C47), K50 (= K50), F114 (≠ Y114), A115 (≠ G115), V139 (≠ T139), Y177 (= Y177), I178 (= I178), R263 (= R263), G302 (= G302), D303 (= D303), E310 (= E310), L311 (= L311), T312 (= T312)
5vdnA 1.55 angstrom resolution crystal structure of glutathione reductase from yersinia pestis in complex with fad
71% identity, 100% coverage: 3:451/451 of query aligns to 2:449/449 of 5vdnA
- active site: L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y177), E180 (= E181), A436 (= A438), H438 (= H440), E443 (= E445)
- binding beta-D-fructopyranose: K35 (= K36), T40 (= T41), G140 (= G141), D157 (= D158)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G12 (= G13), S13 (= S14), G14 (= G15), E33 (= E34), A34 (= A35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), F113 (≠ Y114), A114 (≠ G115), T138 (= T139), G139 (= G140), Y176 (= Y177), I177 (= I178), R262 (= R263), G301 (= G302), D302 (= D303), E308 (= E310), L309 (= L311), T310 (= T312)
P06715 Glutathione reductase; GR; GRase; EC 1.8.1.7 from Escherichia coli (strain K12) (see paper)
69% identity, 100% coverage: 1:451/451 of query aligns to 1:450/450 of P06715
- C42 (= C42) modified: Disulfide link with 47, Redox-active
- C47 (= C47) modified: Disulfide link with 42, Redox-active
1gerB The structure of glutathione reductase from escherichia coli at 1.86 angstroms resolution: comparison with the enzyme from human erythrocytes (see paper)
69% identity, 100% coverage: 3:451/451 of query aligns to 2:449/449 of 1gerB
- active site: L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y177), E180 (= E181), A436 (= A438), H438 (= H440), E443 (= E445)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), E33 (= E34), A34 (= A35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), F113 (≠ Y114), A114 (≠ G115), T138 (= T139), Y176 (= Y177), I177 (= I178), R262 (= R263), G301 (= G302), D302 (= D303), E308 (= E310), L309 (= L311), T310 (= T312)
1getA Anatomy of an engineered NAD-binding site (see paper)
69% identity, 100% coverage: 3:451/451 of query aligns to 1:448/448 of 1getA
- active site: L36 (≠ V38), C40 (= C42), C45 (= C47), K48 (= K50), Y175 (= Y177), E179 (= E181), A435 (= A438), H437 (= H440), E442 (= E445)
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), G11 (= G13), S12 (= S14), E32 (= E34), A33 (= A35), G38 (= G40), T39 (= T41), C40 (= C42), G44 (= G46), C45 (= C47), K48 (= K50), F112 (≠ Y114), A113 (≠ G115), T137 (= T139), I176 (= I178), R261 (= R263), G300 (= G302), D301 (= D303), E307 (= E310), L308 (= L311), T309 (= T312)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A173 (= A175), G174 (= G176), Y175 (= Y177), I176 (= I178), E179 (= E181), R196 (= R198), R202 (= R204), I259 (= I261), G260 (= G262), E307 (= E310), L308 (= L311), V340 (= V343)
1geuA Anatomy of an engineered NAD-binding site (see paper)
67% identity, 100% coverage: 3:451/451 of query aligns to 1:448/448 of 1geuA
- active site: L36 (≠ V38), C40 (= C42), C45 (= C47), K48 (= K50), Y175 (= Y177), E179 (= E181), A435 (= A438), H437 (= H440), E442 (= E445)
- binding flavin-adenine dinucleotide: G9 (= G11), G11 (= G13), S12 (= S14), G13 (= G15), E32 (= E34), A33 (= A35), K34 (= K36), G38 (= G40), T39 (= T41), C40 (= C42), G44 (= G46), C45 (= C47), K48 (= K50), F112 (≠ Y114), A113 (≠ G115), T137 (= T139), G300 (= G302), D301 (= D303), L308 (= L311), T309 (= T312)
- binding nicotinamide-adenine-dinucleotide: Y175 (= Y177), I176 (= I178), E179 (= E181), E195 (≠ V197), M196 (≠ R198), F197 (≠ K199), A258 (= A260), I259 (= I261), G260 (= G262), E307 (= E310), L308 (= L311), V340 (= V343)
5v36A 1.88 angstrom resolution crystal structure of glutathione reductase from streptococcus mutans ua159 in complex with fad
66% identity, 100% coverage: 1:451/451 of query aligns to 2:451/451 of 5v36A
- active site: V39 (= V38), C43 (= C42), C48 (= C47), K51 (= K50), Y178 (= Y177), E182 (= E181), A438 (= A438), H440 (= H440), E445 (= E445)
- binding beta-D-fructopyranose: Y411 (≠ F411), G412 (= G412), D414 (= D414)
- binding flavin-adenine dinucleotide: I11 (≠ L10), G14 (= G13), S15 (= S14), G16 (= G15), E35 (= E34), G36 (≠ A35), G41 (= G40), T42 (= T41), C43 (= C42), G47 (= G46), C48 (= C47), K51 (= K50), Y115 (= Y114), A116 (≠ G115), T140 (= T139), G141 (= G140), Y178 (= Y177), I179 (= I178), R264 (= R263), F271 (≠ I270), G303 (= G302), D304 (= D303), L311 (= L311), T312 (= T312)
6n7fA 1.90 angstrom resolution crystal structure of glutathione reductase from streptococcus pyogenes in complex with fad.
62% identity, 100% coverage: 1:451/451 of query aligns to 2:451/451 of 6n7fA
- active site: C43 (= C42), C48 (= C47), K51 (= K50), Y178 (= Y177), E182 (= E181), H440 (= H440), E445 (= E445)
- binding flavin-adenine dinucleotide: I11 (≠ L10), G12 (= G11), G14 (= G13), S15 (= S14), A16 (≠ G15), A34 (≠ I33), E35 (= E34), G36 (≠ A35), K37 (= K36), G41 (= G40), T42 (= T41), C43 (= C42), G47 (= G46), C48 (= C47), K51 (= K50), Y115 (= Y114), A116 (≠ G115), T140 (= T139), G141 (= G140), Y178 (= Y177), I179 (= I178), R264 (= R263), G303 (= G302), D304 (= D303), L311 (= L311), T312 (= T312)
- binding riboflavin: G36 (≠ A35), K37 (= K36), Y115 (= Y114), G270 (≠ N269)
6b4oA 1.73 angstrom resolution crystal structure of glutathione reductase from enterococcus faecalis in complex with fad
58% identity, 99% coverage: 5:451/451 of query aligns to 6:451/451 of 6b4oA
- active site: I39 (≠ V38), C43 (= C42), C48 (= C47), K51 (= K50), Y178 (= Y177), E182 (= E181), A438 (= A438), H440 (= H440), E445 (= E445)
- binding flavin-adenine dinucleotide: I11 (≠ L10), G14 (= G13), S15 (= S14), G16 (= G15), E35 (= E34), G36 (≠ A35), G41 (= G40), T42 (= T41), C43 (= C42), G47 (= G46), C48 (= C47), K51 (= K50), Y115 (= Y114), A116 (≠ G115), T140 (= T139), G141 (= G140), Y178 (= Y177), I179 (= I178), G303 (= G302), D304 (= D303), D310 (≠ E310), L311 (= L311), T312 (= T312)
6du7A Glutathione reductase from streptococcus pneumoniae (see paper)
56% identity, 96% coverage: 19:451/451 of query aligns to 18:448/448 of 6du7A
- active site: C41 (= C42), C46 (= C47), K49 (= K50), Y176 (= Y177), E180 (= E181), H437 (= H440), E442 (= E445)
- binding flavin-adenine dinucleotide: I32 (= I33), E33 (= E34), E34 (≠ A35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H113 (≠ Y114), A114 (≠ G115), T138 (= T139), Y176 (= Y177), R261 (= R263), G300 (= G302), D301 (= D303), L308 (= L311), T309 (= T312)
Sites not aligning to the query:
2rabA Structure of glutathione amide reductase from chromatium gracile in complex with NAD (see paper)
51% identity, 100% coverage: 3:451/451 of query aligns to 2:444/451 of 2rabA
- active site: S13 (= S14), L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y173 (= Y177), E177 (= E181), I310 (≠ V316), A431 (= A438), H433 (= H440), E438 (= E445)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), I32 (= I33), E33 (= E34), S34 (≠ A35), T40 (= T41), G45 (= G46), C46 (= C47), K49 (= K50), H110 (≠ Y114), A111 (≠ G115), T135 (= T139), G136 (= G140), R258 (= R263), G297 (= G302), D298 (= D303), Q304 (≠ E310), L305 (= L311), T306 (= T312)
- binding nicotinamide-adenine-dinucleotide: K49 (= K50), I169 (≠ V173), G172 (= G176), Y173 (= Y177), I174 (= I178), E177 (= E181), A193 (≠ V197), L194 (≠ R198), E195 (≠ K199), V227 (≠ P231), V256 (≠ I261), G257 (= G262), Q304 (≠ E310), V337 (= V343)
D0VWY5 Glutathione amide reductase; GAR; EC 1.8.1.16 from Marichromatium gracile (Chromatium gracile) (see 2 papers)
51% identity, 100% coverage: 1:451/451 of query aligns to 1:448/463 of D0VWY5
- M1 (= M1) modified: Initiator methionine, Removed
- T2 (≠ A2) binding
- Q3 (= Q3) binding
- H4 (= H4) binding
- SG 14:15 (= SG 14:15) binding
- E34 (= E34) binding
- T41 (= T41) binding
- C42 (= C42) modified: Disulfide link with 47, Redox-active
- C47 (= C47) modified: Disulfide link with 42, Redox-active
- K50 (= K50) binding ; binding
- HA 113:114 (≠ YG 114:115) binding
- 174:180 (vs. 175:181, 71% identical) binding
- LE 197:198 (≠ RK 198:199) binding
- V230 (≠ P231) binding
- G261 (= G262) binding
- D302 (= D303) binding
- Q308 (≠ E310) binding
- QLT 308:310 (≠ ELT 310:312) binding
- V341 (= V343) binding
- H437 (= H440) active site, Proton acceptor; binding
Sites not aligning to the query:
- 2:463 modified: mature protein, Glutathione amide reductase
2r9zB Glutathione amide reductase from chromatium gracile (see paper)
51% identity, 100% coverage: 3:451/451 of query aligns to 2:446/453 of 2r9zB
- active site: S13 (= S14), L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), G74 (≠ N77), Y174 (= Y177), E178 (= E181), I312 (≠ V316), A433 (= A438), H435 (= H440), E440 (= E445)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), I32 (= I33), E33 (= E34), S34 (≠ A35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H111 (≠ Y114), A112 (≠ G115), T136 (= T139), G137 (= G140), I175 (= I178), R260 (= R263), G299 (= G302), D300 (= D303), Q306 (≠ E310), L307 (= L311), T308 (= T312)
5grtA Human glutathione reductase a34e, r37w mutant, glutathionylspermidine complex (see paper)
51% identity, 99% coverage: 5:451/451 of query aligns to 4:461/461 of 5grtA
- active site: L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A438), H450 (= H440), E455 (= E445)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G12 (= G13), G14 (= G15), V32 (≠ I33), E33 (= E34), S34 (≠ A35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ Y114), A113 (≠ G115), T139 (= T139), Y180 (= Y177), G313 (= G302), D314 (= D303), L320 (≠ E310), L321 (= L311), T322 (= T312)
- binding glutathionylspermidine disulfide: S13 (= S14), E17 (≠ A18), C41 (= C42), V42 (= V43), Y89 (= Y91), L93 (≠ I95), I96 (≠ A98), Y97 (= Y99), T322 (= T312), I326 (≠ V316)
4grtA Human glutathione reductase a34e, r37w mutant, mixed disulfide between trypanothione and the enzyme (see paper)
51% identity, 99% coverage: 5:451/451 of query aligns to 4:461/461 of 4grtA
- active site: L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A438), H450 (= H440), E455 (= E445)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), G11 (≠ A12), G12 (= G13), S13 (= S14), G14 (= G15), V32 (≠ I33), E33 (= E34), S34 (≠ A35), H35 (≠ K36), G39 (= G40), T40 (= T41), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ Y114), A113 (≠ G115), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G302), D314 (= D303), L320 (≠ E310), L321 (= L311), T322 (= T312), A325 (= A315)
- binding bis(gamma-glutamyl-cysteinyl-glycinyl)spermidine: S13 (= S14), L16 (≠ I17), E17 (≠ A18), C41 (= C42), V42 (= V43), V47 (= V48), L93 (≠ I95), Y97 (= Y99), I326 (≠ V316)
3grtA Human glutathione reductase a34e, r37w mutant, oxidized trypanothione complex (see paper)
51% identity, 99% coverage: 5:451/451 of query aligns to 4:461/461 of 3grtA
- active site: L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A438), H450 (= H440), E455 (= E445)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), G12 (= G13), S13 (= S14), G14 (= G15), V32 (≠ I33), E33 (= E34), S34 (≠ A35), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ Y114), A113 (≠ G115), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G302), D314 (= D303), L321 (= L311), T322 (= T312)
- binding 2-amino-4-[4-(4-amino-4-carboxy-butyrylamino)-5,8,19,22-tetraoxo-1,2-dithia-6,9,13,18,21-pentaaza-cyclotetracos-23-ylcarbamoyl]-butyric acid: S13 (= S14), E17 (≠ A18), W20 (≠ N21), V42 (= V43), L93 (≠ I95), Y97 (= Y99), T322 (= T312), I326 (≠ V316)
2grtA Human glutathione reductase a34e, r37w mutant, oxidized glutathione complex (see paper)
51% identity, 99% coverage: 5:451/451 of query aligns to 4:461/461 of 2grtA
- active site: L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A438), H450 (= H440), E455 (= E445)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G12 (= G13), S13 (= S14), G14 (= G15), E33 (= E34), S34 (≠ A35), G39 (= G40), T40 (= T41), C41 (= C42), V44 (= V45), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ Y114), A113 (≠ G115), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G302), D314 (= D303), L321 (= L311), T322 (= T312)
- binding oxidized glutathione disulfide: E17 (≠ A18), W20 (≠ N21), V42 (= V43), L93 (≠ I95), I96 (≠ A98), Y97 (= Y99)
P00390 Glutathione reductase, mitochondrial; GR; GRase; EC 1.8.1.7 from Homo sapiens (Human) (see 2 papers)
51% identity, 99% coverage: 5:451/451 of query aligns to 65:522/522 of P00390
- C102 (= C42) modified: Disulfide link with 107, Redox-active
- C107 (= C47) modified: Disulfide link with 102, Redox-active
- C134 (≠ S75) modified: Interchain
- R153 (= R94) to C: in dbSNP:rs8190955
- G232 (≠ K168) to S: in dbSNP:rs8190976
- I261 (≠ V197) to V: in dbSNP:rs8190997
- E297 (≠ N237) to D: in dbSNP:rs8191004
- G374 (= G302) to A: in HAGRD; decreased glutathione reductase activity; decreased enzyme stability; dbSNP:rs1586033745
3djjA Catalytic cycle of human glutathione reductase near 1 a resolution (see paper)
51% identity, 99% coverage: 5:451/451 of query aligns to 5:462/462 of 3djjA
- active site: L38 (≠ V38), C42 (= C42), C47 (= C47), K50 (= K50), Y181 (= Y177), E185 (= E181), A449 (= A438), H451 (= H440), E456 (= E445)
- binding flavin-adenine dinucleotide: G13 (= G13), E34 (= E34), S35 (≠ A35), G40 (= G40), T41 (= T41), G46 (= G46), C47 (= C47), K50 (= K50), H113 (≠ Y114), A114 (≠ G115), T140 (= T139), G141 (= G140), R275 (= R263), G314 (= G302), D315 (= D303), L321 (≠ E310), L322 (= L311), T323 (= T312)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A179 (= A175), G180 (= G176), Y181 (= Y177), I182 (= I178), E185 (= E181), R202 (= R198), R208 (= R204), I273 (= I261), G274 (= G262), L321 (≠ E310), V354 (= V343)
4gr1A The binding of the retro-analogue of glutathione disulfide to glutathione reductase (see paper)
51% identity, 99% coverage: 5:451/451 of query aligns to 4:461/461 of 4gr1A
- active site: L37 (≠ V38), C41 (= C42), C46 (= C47), K49 (= K50), Y180 (= Y177), E184 (= E181), A448 (= A438), H450 (= H440), E455 (= E445)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), E33 (= E34), S34 (≠ A35), G39 (= G40), T40 (= T41), C41 (= C42), G45 (= G46), C46 (= C47), K49 (= K50), H112 (≠ Y114), A113 (≠ G115), T139 (= T139), G140 (= G140), Y180 (= Y177), G313 (= G302), D314 (= D303), L321 (= L311), T322 (= T312)
- binding 4n-malonyl-cysteinyl-2,4-diaminobutyrate disulfide: L93 (≠ I95), Y97 (= Y99), R330 (= R320)
Query Sequence
>7026925 FitnessBrowser__ANA3:7026925
MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKHVGGTCVNVGCVPKKVMWYGAHIA
EAMNLYAKDYGFDVSVNKFDWNTLVNSREAYIGRIHEAYGRGFTNNKVTLLNGYGRFVNG
NTIEVNGEHYTADHILIATGGAPTIPNIPGAEYGIDSDGFFALREQPKRVAVVGAGYIAV
EVAGVLHALGSETHLFVRKHAPLRNFDPMLIDALVDAMKTEGPTLHTNSVPQSVVKNADD
SLTLNLENGESVTVDCLIWAIGRSPATGNIGLENTDVQLDSKGYVITDAQQNTTHKGIYC
VGDIMAGGVELTPVAVKAGRLLSERLFNGMSDAKMDYSQIPTVVFSHPPIGTMGLTEPEA
RAQYGDDNVKVYTSGFTSMYTAVTSHRQACKMKLVCAGKEEKVVGIHGIGFGMDEILQGF
GVAMKMGATKADFDAVVAIHPTGAEEFVTMR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory