Comparing 7026950 FitnessBrowser__ANA3:7026950 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q0P9C4 Protein glycosylation K; EC 7.5.2.5 from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) (see 2 papers)
35% identity, 83% coverage: 16:210/235 of query aligns to 360:556/564 of Q0P9C4
Sites not aligning to the query:
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
32% identity, 84% coverage: 16:213/235 of query aligns to 14:214/220 of 8tzjA
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
30% identity, 83% coverage: 21:215/235 of query aligns to 20:218/230 of 6z4wA
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 83% coverage: 21:215/235 of query aligns to 20:218/229 of 6z67B
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 92% coverage: 6:222/235 of query aligns to 2:220/240 of 4ymuJ
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
36% identity, 75% coverage: 20:195/235 of query aligns to 18:188/247 of 4zirB
Sites not aligning to the query:
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
36% identity, 75% coverage: 20:195/235 of query aligns to 19:192/249 of 4hluC
Sites not aligning to the query:
5nbdA Pglk flippase in complex with inhibitory nanobody (see paper)
31% identity, 83% coverage: 16:210/235 of query aligns to 360:556/564 of 5nbdA
6hrcB Outward-facing pglk with atpgammas bound (see paper)
31% identity, 83% coverage: 16:210/235 of query aligns to 360:556/564 of 6hrcB
Sites not aligning to the query:
6hrcA Outward-facing pglk with atpgammas bound (see paper)
31% identity, 83% coverage: 16:210/235 of query aligns to 360:556/564 of 6hrcA
Sites not aligning to the query:
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
30% identity, 73% coverage: 25:196/235 of query aligns to 23:198/229 of A5U7B7
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
30% identity, 73% coverage: 25:196/235 of query aligns to 24:199/225 of 8iddA
Sites not aligning to the query:
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
30% identity, 73% coverage: 25:196/235 of query aligns to 24:199/227 of 8igqA
Sites not aligning to the query:
6tejB Structure of apo irtab devoid sid in complex with sybody syb_nl5 (see paper)
30% identity, 87% coverage: 10:214/235 of query aligns to 335:548/585 of 6tejB
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
32% identity, 77% coverage: 15:195/235 of query aligns to 12:196/219 of 8w6iD
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
32% identity, 77% coverage: 15:195/235 of query aligns to 12:196/222 of P0A9R7
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
29% identity, 83% coverage: 25:219/235 of query aligns to 22:220/222 of 8i6rB
Sites not aligning to the query:
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
32% identity, 77% coverage: 15:195/235 of query aligns to 12:196/218 of 8hd0A
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 84% coverage: 9:205/235 of query aligns to 7:203/369 of P19566
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 88% coverage: 9:215/235 of query aligns to 6:215/241 of 4u00A
>7026950 FitnessBrowser__ANA3:7026950
MTQAKLIARDLEMSFGPRLLFKAHSLELCQGNVIYLQGDNGSGKSTLMKILAGLQPPSKG
KIEVSGFKKDAWWTRNPLLGKAVYLHQHPYLFDGTVNYNLTYGLPFAASKTEAKRRIGQA
IEMAQLGSLLQARASNLSGGERQRLAIARAWILQPKLLMLDEPTSNMDKDSQALVLQMIQ
QLKQQGTGMLLSSHQNCALTAICEQQWHIEDQQVITSRQQTPTNSTQGSLYVVAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory