SitesBLAST
Comparing 7026997 FitnessBrowser__ANA3:7026997 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WNP5 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
66% identity, 97% coverage: 9:300/300 of query aligns to 20:314/314 of P9WNP5
- R58 (≠ L46) binding in other chain
- K95 (= K83) binding in other chain
- SGGDQ 103:107 (= SGGDQ 90:94) binding in other chain
- R133 (= R119) mutation to A: Loss of DHNA-CoA synthase activity.
- WAAGG 157:161 (≠ WAVGG 143:147) binding in other chain
- T184 (= T170) binding in other chain
- D185 (= D171) mutation to E: Nearly abolishes DHNA-CoA synthase activity.; mutation D->G,N: Loss of DHNA-CoA synthase activity.
- S190 (= S176) mutation to A: Reduces affinity for substrate. Nearly abolishes DHNA-CoA synthase activity.
- D192 (= D178) mutation to N: Loss of DHNA-CoA synthase activity.
- Y287 (= Y273) mutation to F: Loss of DHNA-CoA synthase activity.
4qijA Crystal structure of menb from mycobacteria tuberculosis in complex with 1-hna-coa (see paper)
66% identity, 97% coverage: 9:300/300 of query aligns to 7:301/301 of 4qijA
- active site: G92 (= G92), R97 (= R97), Y102 (= Y102), R117 (= R116), H122 (= H121), G148 (= G147), S151 (= S150), D172 (= D171), S177 (= S176), D179 (= D178), G180 (≠ S179), A266 (= A265), Y274 (= Y273)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ C45), R45 (≠ L46), A47 (= A48), F48 (= F49), K82 (= K83), S90 (= S90), G91 (= G91), G92 (= G92), D93 (= D93), Q94 (= Q94), Y102 (= Y102), L121 (= L120), I123 (= I122), W144 (= W143), G148 (= G147), T171 (= T170), D172 (= D171), S177 (= S176), F286 (= F285), K289 (= K288)
4qiiB Crystal structure of type ii menb from mycobacteria tuberculosis (see paper)
66% identity, 97% coverage: 9:300/300 of query aligns to 7:301/301 of 4qiiB
- active site: G92 (= G92), R97 (= R97), Y102 (= Y102), R117 (= R116), H122 (= H121), G148 (= G147), S151 (= S150), D172 (= D171), S177 (= S176), D179 (= D178), G180 (≠ S179), A266 (= A265), Y274 (= Y273)
- binding Salicylyl CoA: V44 (≠ C45), R45 (≠ L46), A47 (= A48), K82 (= K83), S90 (= S90), G92 (= G92), D93 (= D93), Q94 (= Q94), Y102 (= Y102), W144 (= W143), G147 (= G146), G148 (= G147), T171 (= T170), D172 (= D171), V175 (= V174), S177 (= S176), Y274 (= Y273), F286 (= F285), K289 (= K288)
1q51B Crystal structure of mycobacterium tuberculosis menb in complex with acetoacetyl-coenzyme a, a key enzyme in vitamin k2 biosynthesis (see paper)
64% identity, 97% coverage: 9:300/300 of query aligns to 3:280/280 of 1q51B
- active site: G88 (= G92), H101 (= H121), G127 (= G147), S130 (= S150), D151 (= D171), S156 (= S176), D158 (= D178), G159 (≠ S179), A245 (= A265), Y253 (= Y273)
- binding acetoacetyl-coenzyme a: V40 (≠ C45), R41 (≠ L46), A43 (= A48), S86 (= S90), G88 (= G92), D89 (= D93), Q90 (= Q94), W123 (= W143), G126 (= G146), G127 (= G147), T150 (= T170)
1rjnB The crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa (see paper)
62% identity, 97% coverage: 9:300/300 of query aligns to 7:275/275 of 1rjnB
- active site: G92 (= G92), H96 (= H121), G122 (= G147), S125 (= S150), D146 (= D171), S151 (= S176), D153 (= D178), G154 (≠ S179), A240 (= A265)
- binding coenzyme a: V44 (≠ C45), R45 (≠ L46), K82 (= K83), S90 (= S90), G92 (= G92), D93 (= D93), Q94 (= Q94), W118 (= W143)
- binding 3-[4-(2-hydroxyethyl)piperazin-1-yl]propane-1-sulfonic acid: R163 (≠ K188), Q164 (≠ M189), V165 (≠ I190), M188 (= M213)
1q51A Crystal structure of mycobacterium tuberculosis menb in complex with acetoacetyl-coenzyme a, a key enzyme in vitamin k2 biosynthesis (see paper)
62% identity, 97% coverage: 9:300/300 of query aligns to 3:271/271 of 1q51A
- active site: G88 (= G92), H92 (= H121), G118 (= G147), S121 (= S150), D142 (= D171), S147 (= S176), D149 (= D178), G150 (≠ S179), A236 (= A265), Y244 (= Y273)
- binding acetoacetyl-coenzyme a: V40 (≠ C45), R41 (≠ L46), K78 (= K83), S86 (= S90), G88 (= G92), D89 (= D93), Q90 (= Q94), W114 (= W143), G117 (= G146), G118 (= G147), T141 (= T170)
3t8aB Crystal structure of mycobacterium tuberculosis menb in complex with substrate analogue, osb-ncoa (see paper)
63% identity, 97% coverage: 9:300/300 of query aligns to 6:274/274 of 3t8aB
- active site: G91 (= G92), H97 (= H121), G123 (= G147), S126 (= S150), D147 (= D171), S152 (= S176), D154 (= D178), G155 (≠ S179), A241 (= A265), Y249 (= Y273)
- binding o-succinylbenzoyl-N-coenzyme A: V43 (≠ C45), R44 (≠ L46), K81 (= K83), S89 (= S90), G91 (= G92), D92 (= D93), Q93 (= Q94), W119 (= W143)
4i52A Scmenb im complex with 1-hydroxy-2-naphthoyl-coa (see paper)
55% identity, 93% coverage: 21:298/300 of query aligns to 8:273/275 of 4i52A
- active site: G77 (= G92), R82 (= R97), Y87 (= Y102), R95 (= R119), L99 (= L123), G123 (= G147), V126 (≠ S150), G146 (≠ D171), S151 (= S176), D153 (= D178), G154 (≠ S179), A240 (= A265), Y248 (= Y273)
- binding 1-hydroxy-2-naphthoyl-CoA: H29 (≠ D44), K30 (≠ C45), R31 (≠ L46), A33 (= A48), S75 (= S90), G76 (= G91), G77 (= G92), D78 (= D93), Q79 (= Q94), L96 (= L120), V98 (≠ I122), Y119 (≠ W143), I121 (≠ V145), G123 (= G147), T145 (= T170), V149 (= V174), S151 (= S176), F152 (= F177)
4i4zA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa (see paper)
55% identity, 93% coverage: 21:298/300 of query aligns to 8:273/275 of 4i4zA
- active site: G77 (= G92), R82 (= R97), Y87 (= Y102), R95 (= R119), L99 (= L123), G123 (= G147), V126 (≠ S150), G146 (≠ D171), S151 (= S176), D153 (= D178), G154 (≠ S179), A240 (= A265), Y248 (= Y273)
- binding Salicylyl CoA: H29 (≠ D44), K30 (≠ C45), R31 (≠ L46), S75 (= S90), G76 (= G91), G77 (= G92), D78 (= D93), Q79 (= Q94), Y87 (= Y102), V98 (≠ I122), G123 (= G147), T145 (= T170), V149 (= V174), S151 (= S176), F260 (= F285), K263 (= K288)
- binding bicarbonate ion: G122 (= G146), Q144 (= Q169), T145 (= T170), G146 (≠ D171), W174 (≠ F199)
4emlA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with bicarbonate (see paper)
53% identity, 93% coverage: 21:298/300 of query aligns to 8:259/261 of 4emlA
- active site: G77 (= G92), R81 (= R119), L85 (= L123), G109 (= G147), V112 (≠ S150), G132 (≠ D171), S137 (= S176), D139 (= D178), G140 (≠ S179), A226 (= A265), Y234 (= Y273)
- binding bicarbonate ion: G108 (= G146), Q130 (= Q169), G132 (≠ D171), W160 (≠ F199)
- binding chloride ion: D184 (≠ A223), R185 (≠ E224), E187 (= E226), E188 (≠ V227)
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
49% identity, 92% coverage: 22:296/300 of query aligns to 74:333/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
49% identity, 92% coverage: 22:297/300 of query aligns to 12:270/273 of Q5HH38
- R34 (≠ L46) binding in other chain
- SGGDQ 73:77 (= SGGDQ 90:94) binding in other chain
- S149 (= S176) binding in other chain
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
48% identity, 92% coverage: 22:297/300 of query aligns to 7:257/260 of 2uzfA
- active site: G70 (= G92), R80 (= R119), L84 (= L123), G108 (= G147), V111 (≠ S150), T130 (= T170), G131 (≠ D171), S136 (= S176), D138 (= D178), A139 (≠ S179), A225 (= A265), Y233 (= Y273)
- binding acetoacetyl-coenzyme a: V28 (≠ C45), R29 (≠ L46), S68 (= S90), G69 (= G91), G70 (= G92), D71 (= D93), Y104 (≠ W143), G108 (= G147)
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
46% identity, 96% coverage: 8:296/300 of query aligns to 9:281/285 of 4i42A
- active site: G86 (= G92), R91 (= R97), Y97 (≠ K111), H105 (≠ R119), L109 (= L123), G133 (= G147), V136 (≠ S150), G156 (≠ D171), S161 (= S176), D163 (= D178), G164 (≠ S179), A250 (= A265), Y258 (= Y273)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ C45), R45 (≠ L46), S84 (= S90), G85 (= G91), G86 (= G92), D87 (= D93), Q88 (= Q94), K89 (≠ R95), Y97 (≠ K111), V108 (≠ I122), Y129 (≠ W143), G133 (= G147), T155 (= T170), S161 (= S176), T254 (= T269), F270 (= F285), K273 (= K288)
P0ABU0 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Escherichia coli (strain K12) (see 4 papers)
46% identity, 96% coverage: 8:296/300 of query aligns to 9:281/285 of P0ABU0
- R45 (≠ L46) binding in other chain
- SGGDQK 84:89 (≠ SGGDQR 90:95) binding in other chain
- K89 (≠ R95) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- R91 (= R97) mutation to A: Loss of DHNA-CoA synthase activity.
- Y97 (≠ K111) binding in other chain; mutation to F: Loss of DHNA-CoA synthase activity.
- YSIGG 129:133 (≠ WAVGG 143:147) binding in other chain
- Q154 (= Q169) mutation to A: Reduces the specific DHNA-CoA synthase activity by 15-fold, whereas its affinity for hydrogencarbonate is reduced by 36-fold.
- QTG 154:156 (≠ QTD 169:171) binding
- T155 (= T170) binding in other chain
- G156 (≠ D171) mutation to D: Loss of DHNA-CoA synthase activity.
- S161 (= S176) binding in other chain
- W184 (≠ F199) mutation to F: Reduces the specific DHNA-CoA synthase activity by 530-fold, whereas its affinity for hydrogencarbonate is reduced by 20-fold.
- Y258 (= Y273) binding
- R267 (= R282) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- F270 (= F285) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- K273 (= K288) binding ; mutation to A: Impairs protein folding.
3t88A Crystal structure of escherichia coli menb in complex with substrate analogue, osb-ncoa (see paper)
46% identity, 96% coverage: 8:296/300 of query aligns to 5:277/281 of 3t88A
- active site: G82 (= G92), R87 (= R97), Y93 (≠ K111), H101 (≠ R119), L105 (= L123), G129 (= G147), V132 (≠ S150), G152 (≠ D171), S157 (= S176), D159 (= D178), G160 (≠ S179), A246 (= A265), Y254 (= Y273)
- binding o-succinylbenzoyl-N-coenzyme A: Q39 (≠ D44), V40 (≠ C45), R41 (≠ L46), A43 (= A48), S80 (= S90), G81 (= G91), G82 (= G92), D83 (= D93), Q84 (= Q94), K85 (≠ R95), Y93 (≠ K111), V104 (≠ I122), L105 (= L123), Y125 (≠ W143), G129 (= G147), T151 (= T170), V155 (= V174), F158 (= F177), D159 (= D178), T250 (= T269), Y254 (= Y273), F266 (= F285), K269 (= K288)
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
46% identity, 96% coverage: 8:296/300 of query aligns to 9:281/285 of Q7CQ56
4elwA Structure of e. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate (see paper)
44% identity, 96% coverage: 8:296/300 of query aligns to 6:263/267 of 4elwA
- active site: G83 (= G92), L91 (= L123), G115 (= G147), V118 (≠ S150), G138 (≠ D171), S143 (= S176), D145 (= D178), G146 (≠ S179), A232 (= A265), Y240 (= Y273)
- binding nitrate ion: G114 (= G146), T137 (= T170), G138 (≠ D171), F144 (= F177), W166 (≠ F199)
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
44% identity, 96% coverage: 8:296/300 of query aligns to 6:264/268 of 4elxA
- active site: G83 (= G92), H88 (≠ R119), L92 (= L123), G116 (= G147), V119 (≠ S150), G139 (≠ D171), S144 (= S176), D146 (= D178), G147 (≠ S179), A233 (= A265), Y241 (= Y273)
- binding chloride ion: G115 (= G146), G139 (≠ D171), W167 (≠ F199)
3h02A 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
44% identity, 96% coverage: 8:296/300 of query aligns to 5:262/266 of 3h02A
- active site: G82 (= G92), H86 (≠ R119), L90 (= L123), G114 (= G147), V117 (≠ S150), G137 (≠ D171), S142 (= S176), D144 (= D178), G145 (≠ S179), A231 (= A265), Y239 (= Y273)
- binding bicarbonate ion: G113 (= G146), Q135 (= Q169), G137 (≠ D171), W165 (≠ F199)
Query Sequence
>7026997 FitnessBrowser__ANA3:7026997
MTKPVSDIFDPALWDEVSGFNFDDITYHRAKAHGTVRIAINRPDCLNAFRPKTVDELYIA
LDHARQWSDVGCVLLTGNGPSAKGQYSFSSGGDQRIRGKDGYKYEGAEEGKADLARMGRL
HILEVQRLIRFMPKVVIAVVPGWAVGGGHSLHVVCDLTLASKEHAVFKQTDPDVASFDSG
YGSAYLAKMIGQKRAREIFFCGFNYSADEAFAMGMVNKSVPHAELEVEALRWAKEINSKS
PTAMRMLKYGFNMTDDGMVGQQLFAGEATRLAYASAEAQEGRDAFLEKRDQDFSAFPWHY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory