Comparing 71 a.a. (MSSPNTETLT...) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
O35019 UPF0435 protein YfkK from Bacillus subtilis (strain 168) (see paper)
100% identity, 100% coverage: 1:71/71 of query aligns to 1:71/71 of O35019
>71 a.a. (MSSPNTETLT...)
MSSPNTETLTQMIEEISQKLNMLNVGVIKAEDFSDEKIEDLTYLHRMVMKKESFSPSEMQ
AIAQELASLRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory