Comparing 8499235 FitnessBrowser__Miya:8499235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7d53A Spua mutant - h221n with glu (see paper)
33% identity, 75% coverage: 30:185/207 of query aligns to 26:222/249 of 7d53A
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 54% coverage: 77:187/207 of query aligns to 155:281/308 of O33341
Sites not aligning to the query:
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
33% identity, 75% coverage: 30:185/207 of query aligns to 32:228/255 of 7d50B
7d4rB Spua native structure (see paper)
33% identity, 75% coverage: 30:185/207 of query aligns to 24:190/215 of 7d4rB
3fijA Crystal structure of a uncharacterized protein lin1909
31% identity, 61% coverage: 60:185/207 of query aligns to 42:200/224 of 3fijA
>8499235 FitnessBrowser__Miya:8499235
MNARLALTMRVTEAPGHAERRDALAQDWGRFLAVALPGAAWLPMPNAGDDAVRLADAFAV
NGLVLTGGDDWGVFSERDATEAALFRWAMARDIPVLGVCRGAQVINRMLGGSARVTDGAV
HAGTRHPLTERQDWTPEDVNSYHRLVLDRDMLAPGLASAALAPDGTVEAFHLPGRRVVGV
LWHPEREHPYGACDVALMQRLFTPEQI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory