SitesBLAST
Comparing 8499289 FitnessBrowser__Miya:8499289 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
49% identity, 53% coverage: 122:258/259 of query aligns to 58:178/193 of 2vpyF
- binding pentachlorophenol: I91 (= I155), C93 (= C157)
- binding iron/sulfur cluster: C58 (= C122), L59 (≠ N123), C61 (= C125), P65 (= P129), C66 (= C130), C70 (= C134), P71 (= P135), V83 (= V147), C90 (= C154), I91 (= I155), A92 (≠ G156), C93 (= C157), G94 (≠ R158), C96 (= C160), C100 (= C164), P101 (= P165), Y102 (= Y166), R105 (= R169), V113 (= V195), C116 (= C198), F118 (= F200), C119 (= C201), P129 (= P211), A130 (= A212), C131 (= C213), C135 (≠ S217), C139 (≠ I221), R140 (vs. gap)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 15, 16, 19, 23, 27, 36, 38, 55, 57, 189, 190
2vpwF Polysulfide reductase with bound menaquinone (see paper)
49% identity, 53% coverage: 122:258/259 of query aligns to 58:178/193 of 2vpwF
- binding iron/sulfur cluster: C58 (= C122), L59 (≠ N123), H60 (= H124), C61 (= C125), P65 (= P129), C66 (= C130), C70 (= C134), P71 (= P135), V83 (= V147), C90 (= C154), I91 (= I155), A92 (≠ G156), C93 (= C157), G94 (≠ R158), C96 (= C160), C100 (= C164), P101 (= P165), Y102 (= Y166), R105 (= R169), V113 (= V195), C116 (= C198), F118 (= F200), C119 (= C201), P129 (= P211), A130 (= A212), C131 (= C213), C135 (≠ S217), C139 (≠ I221), R140 (vs. gap)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 15, 16, 19, 23, 27, 36, 38, 55, 57, 189, 190
6f0kB Alternative complex iii (see paper)
32% identity, 81% coverage: 50:258/259 of query aligns to 722:948/961 of 6f0kB
- binding fe3-s4 cluster: C803 (= C134), V805 (≠ T136), M818 (= M149), C823 (= C154), I824 (= I155), G825 (= G156), C829 (= C160), M869 (≠ V195)
- binding heme c: N821 (≠ H152), R822 (= R153), R884 (≠ L210), N887 (≠ C213)
- binding iron/sulfur cluster: C733 (≠ R64), T734 (≠ E65), G735 (≠ D66), C736 (≠ F67), N737 (≠ E68), A738 (≠ R69), C739 (≠ I70), C743 (= C74), W765 (= W91), I768 (≠ T94), C791 (= C122), M792 (≠ N123), H793 (= H124), C794 (= C125), P798 (= P129), C799 (= C130), N816 (≠ V147), C833 (= C164), C872 (= C198), Y874 (≠ F200), C875 (= C201), A901 (vs. gap), C902 (vs. gap), C906 (vs. gap)
Sites not aligning to the query:
6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
38% identity, 57% coverage: 111:258/259 of query aligns to 46:225/234 of 6cz7B
- binding iron/sulfur cluster: Y52 (≠ D117), P54 (≠ L119), C57 (= C122), N58 (= N123), H59 (= H124), C60 (= C125), A63 (≠ P128), P64 (= P129), C65 (= C130), C69 (= C134), P70 (= P135), T82 (≠ V147), C89 (= C154), I90 (= I155), G91 (= G156), C92 (= C157), K93 (≠ R158), C95 (= C160), C99 (= C164), Y101 (= Y166), V103 (≠ A168), I104 (≠ R169), T161 (≠ V195), K163 (= K197), C164 (= C198), F166 (= F200), C167 (= C201), C179 (= C213), C183 (≠ S217), P184 (vs. gap), R188 (≠ I221)
Sites not aligning to the query:
Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
38% identity, 57% coverage: 111:258/259 of query aligns to 46:225/234 of Q7WTT9
- C57 (= C122) binding
- C60 (= C125) binding
- C65 (= C130) binding
- C69 (= C134) binding
- C89 (= C154) binding
- C92 (= C157) binding
- C95 (= C160) binding
- C99 (= C164) binding
- C164 (= C198) binding
- C167 (= C201) binding
- C179 (= C213) binding
- C183 (≠ S217) binding
Sites not aligning to the query:
- 12 binding
- 15 binding
- 18 binding
- 22 binding
6lodB Cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii (see paper)
30% identity, 84% coverage: 42:258/259 of query aligns to 673:917/929 of 6lodB
- binding fe3-s4 cluster: V758 (= V133), C759 (= C134), P760 (= P135), C779 (= C154), V780 (≠ I155), G781 (= G156), T782 (≠ C157), C785 (= C160), M838 (≠ V195)
- binding heme c: N777 (≠ H152), R778 (= R153), R852 (vs. gap), I853 (vs. gap), R856 (vs. gap)
- binding iron/sulfur cluster: C692 (≠ L61), N693 (≠ E62), S694 (= S63), C695 (≠ F67), N696 (≠ E68), A697 (≠ R69), C698 (≠ I70), C702 (= C74), N706 (≠ H78), W724 (= W91), I727 (≠ T94), L746 (= L121), C747 (= C122), Q748 (≠ N123), Q749 (≠ H124), C750 (= C125), P754 (= P129), C755 (= C130), N772 (≠ V147), C789 (= C164), Y791 (= Y166), V793 (≠ A168), R794 (= R169), K840 (= K197), C841 (= C198), F843 (= F200), C844 (= C201), T869 (≠ P211), C871 (= C213), C875 (vs. gap), I880 (= I221)
6btmB Structure of alternative complex iii from flavobacterium johnsoniae (wild type) (see paper)
28% identity, 72% coverage: 73:259/259 of query aligns to 702:944/948 of 6btmB
- binding fe3-s4 cluster: C789 (= C134), C809 (= C154), V810 (≠ I155), T812 (≠ C157), C815 (= C160), M862 (≠ V195)
- binding iron/sulfur cluster: C777 (= C122), Q778 (≠ N123), C780 (= C125), C785 (= C130), N802 (≠ V147), C819 (= C164), R824 (= R169)
Sites not aligning to the query:
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
38% identity, 53% coverage: 121:258/259 of query aligns to 135:258/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C134), T150 (= T136), I153 (≠ T139), C169 (= C154), K170 (≠ I155), G171 (= G156), H172 (≠ C157), R173 (= R158), H174 (≠ F159), C175 (= C160), S193 (≠ R190)
- binding protoporphyrin ix containing fe: T150 (= T136), K170 (≠ I155), H172 (≠ C157)
- binding iron/sulfur cluster: M135 (≠ L121), C136 (= C122), N137 (= N123), H138 (= H124), C139 (= C125), P142 (= P128), C144 (= C130), V162 (= V147), C179 (= C164), A183 (= A168), I184 (≠ R169), K195 (= K197), C196 (= C198), I197 (≠ T199), L198 (≠ F200), C199 (= C201), N209 (≠ P211), C211 (= C213), C215 (≠ S217), V219 (≠ I221), R220 (vs. gap)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41
5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
36% identity, 53% coverage: 121:258/259 of query aligns to 132:255/329 of 5ch7B
- binding fe3-s4 cluster: C145 (= C134), I150 (≠ T139), C166 (= C154), K167 (≠ I155), G168 (= G156), A169 (≠ C157), Q170 (≠ R158), A171 (≠ F159), C172 (= C160), A190 (≠ V183)
- binding iron/sulfur cluster: C133 (= C122), N134 (= N123), C136 (= C125), P139 (= P128), C141 (= C130), C176 (= C164), C193 (= C198), G195 (≠ F200), C196 (= C201), C208 (= C213), C212 (≠ S217), V213 (≠ N218), G214 (= G219)
Sites not aligning to the query:
- binding iron/sulfur cluster: 17, 18, 19, 20, 21, 23, 27, 31, 43, 45, 130
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
35% identity, 52% coverage: 120:253/259 of query aligns to 65:191/205 of P18776
- C102 (= C157) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3egwB The crystal structure of the narghi mutant narh - c16a
38% identity, 46% coverage: 121:240/259 of query aligns to 183:288/509 of 3egwB
- binding fe3-s4 cluster: C196 (= C134), S198 (≠ T136), I201 (≠ T139), C217 (= C154), R218 (≠ I155), G219 (= G156), W220 (≠ C157), R221 (= R158), C223 (= C160), S241 (≠ V195), C263 (≠ S217), G265 (= G219), R268 (≠ L222)
- binding protoporphyrin ix containing fe: W220 (≠ C157), R221 (= R158)
- binding iron/sulfur cluster: C184 (= C122), E185 (≠ N123), H186 (= H124), C187 (= C125), P190 (= P128), C192 (= C130), C227 (= C164), I232 (≠ R169), K243 (= K197), C244 (= C198), F246 (= F200), C247 (= C201), T257 (≠ P211), C259 (= C213)
Sites not aligning to the query:
P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 46% coverage: 121:240/259 of query aligns to 183:288/512 of P11349
- C184 (= C122) binding
- C187 (= C125) binding
- C192 (= C130) binding
- C196 (= C134) binding
- C217 (= C154) binding
- C223 (= C160) binding
- C227 (= C164) binding
- C244 (= C198) binding
- C247 (= C201) binding
- C259 (= C213) binding
- C263 (≠ S217) binding
Sites not aligning to the query:
- 16 binding
- 19 binding
- 22 binding
- 26 binding
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
40% identity, 40% coverage: 122:224/259 of query aligns to 100:187/294 of P0AAJ3
- C100 (= C122) binding
- C103 (= C125) binding
- C108 (= C130) binding
- C112 (= C134) binding
- C133 (= C154) binding
- C136 (= C157) binding
- C139 (= C160) binding
- C143 (= C164) binding
- C160 (= C198) binding
- C163 (= C201) binding
- C175 (= C213) binding
- C179 (≠ S217) binding
Sites not aligning to the query:
- 39 binding
- 42 binding
- 45 binding
- 49 binding
1kqfB Formate dehydrogenase n from e. Coli (see paper)
40% identity, 40% coverage: 122:224/259 of query aligns to 99:186/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (≠ F159)
- binding iron/sulfur cluster: C99 (= C122), M100 (≠ N123), H101 (= H124), C102 (= C125), P105 (= P128), C107 (= C130), C111 (= C134), P112 (= P135), I117 (≠ T139), V125 (= V147), C132 (= C154), I133 (= I155), G134 (= G156), C135 (= C157), G136 (≠ R158), Y137 (≠ F159), C138 (= C160), C142 (= C164), I146 (≠ A168), P147 (≠ R169), V156 (≠ P178), K158 (= K197), C159 (= C198), L161 (≠ F200), C162 (= C201), P172 (= P211), C174 (= C213), C178 (≠ S217), P179 (vs. gap), I183 (= I221)
Sites not aligning to the query:
- binding protoporphyrin ix containing fe: 252
- binding iron/sulfur cluster: 31, 38, 39, 40, 41, 42, 44, 48, 52, 77, 79
7b04A of Nitrite oxidoreductase (Nxr) from the anammox bacterium Kuenenia stuttgartiensis.
35% identity, 53% coverage: 121:258/259 of query aligns to 173:305/409 of 7b04A
- binding fe3-s4 cluster: C186 (= C134), I191 (≠ T139), C207 (= C154), R208 (≠ I155), G209 (= G156), Y210 (≠ C157), R211 (= R158), K212 (≠ F159), C213 (= C160), S231 (≠ V195)
- binding protoporphyrin ix containing fe: R188 (≠ T136), R208 (≠ I155), Y210 (≠ C157)
- binding iron/sulfur cluster: I173 (≠ L121), C174 (= C122), N175 (= N123), H176 (= H124), C177 (= C125), P180 (= P128), C182 (= C130), C217 (= C164), P222 (= P178), K233 (= K197), C234 (= C198), A236 (≠ F200), C237 (= C201), T255 (≠ P211), R256 (≠ A212), C257 (= C213), C261 (≠ S217), V262 (≠ N218), I265 (= I221), R266 (vs. gap)
Sites not aligning to the query:
- binding iron/sulfur cluster: 34, 35, 36, 37, 38, 40, 44, 48, 59, 60, 62, 171
7qv7A Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
36% identity, 44% coverage: 122:234/259 of query aligns to 51:159/174 of 7qv7A
- binding iron/sulfur cluster: C51 (= C122), R52 (≠ N123), C54 (= C125), C59 (= C130), C63 (= C134), C82 (= C154), I83 (= I155), G84 (= G156), C85 (= C157), C88 (= C160), C92 (= C164), I97 (≠ R169), F99 (= F171), C125 (= C198), L127 (≠ F200), C128 (= C201), A136 (= A212), C137 (= C213), C141 (≠ A216)
Sites not aligning to the query:
4v4cB Pyrogallol hydroxytransferase small subunit (see paper)
24% identity, 80% coverage: 50:257/259 of query aligns to 2:188/274 of 4v4cB
- binding calcium ion: I61 (≠ M105), N62 (≠ S106)
- binding iron/sulfur cluster: C13 (≠ L61), Q14 (≠ E62), D15 (= D66), C16 (≠ F67), N17 (≠ E68), N18 (≠ R69), C19 (≠ I70), C23 (= C74), C68 (= C122), M69 (≠ N123), H70 (= H124), C71 (= C125), C76 (= C130), V92 (= V147), C109 (= C164), V113 (≠ A168), C126 (= C198), M128 (≠ F200), C129 (= C201), P143 (= P211), C145 (= C213), C149 (≠ S217), S151 (≠ G219), V153 (≠ I221), Y154 (≠ L222)
7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
36% identity, 37% coverage: 122:216/259 of query aligns to 63:153/183 of 7qv7B
- binding iron/sulfur cluster: C63 (= C122), R64 (≠ N123), H65 (= H124), C66 (= C125), A69 (≠ P128), C71 (= C130), C75 (= C134), A79 (≠ T139), I80 (≠ F140), C94 (= C154), I95 (= I155), C97 (= C157), C100 (= C160), C104 (= C164), I109 (≠ R169), C139 (= C198), L141 (≠ F200), C142 (= C201), P148 (= P211), C150 (= C213)
Sites not aligning to the query:
- binding iron/sulfur cluster: 14, 16, 17, 18, 19, 20, 24, 28, 48, 154, 155, 159
7z0sB Structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) (see paper)
43% identity, 22% coverage: 121:176/259 of query aligns to 50:104/170 of 7z0sB
- binding iron/sulfur cluster: L50 (= L121), C51 (= C122), H52 (≠ N123), H53 (= H124), C54 (= C125), C59 (= C130), C63 (= C134), P64 (= P135), I68 (≠ F140), V75 (= V147), L77 (≠ M149), C82 (= C154), V83 (≠ I155), C85 (= C157), K86 (≠ R158), C88 (= C160), C92 (= C164), I97 (≠ R169)
Sites not aligning to the query:
- binding iron/sulfur cluster: 12, 13, 14, 15, 16, 17, 18, 22, 26, 36, 37, 48, 140, 142, 143, 144, 145, 146, 153, 155, 159, 160, 161, 164
Query Sequence
>8499289 FitnessBrowser__Miya:8499289
MSTTRRQFLKIAGLAAFGLGTSSALDAADAVAKDMPGAKYDVGGKHLAAKRWAMVIDTRK
LESREDFERIIHACHSVHNVPSIPSKQEIKWIWTDKYDRVFTDDMSQHLSPAVREKDYLL
LCNHCENPPCVRVCPTKATFKRADGIVVMDYHRCIGCRFCMAGCPYGARSFNFGDPRPYL
KDVNPAFPTRMRGVVEKCTFCSERLEVGLLPACVEASNGAILFGDLDDPNSPVRKALAEN
FSIRRKPSIGTQPGVYYIV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory