SitesBLAST
Comparing 8499360 FitnessBrowser__Miya:8499360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2c20A Crystal structure of udp-glucose 4-epimerase
48% identity, 97% coverage: 8:354/356 of query aligns to 2:323/329 of 2c20A
- active site: T117 (= T126), A118 (= A127), A119 (= A128), Y141 (= Y150), K145 (= K154), H184 (= H193)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), Y11 (= Y17), I12 (= I18), D31 (= D37), N32 (= N38), Q34 (≠ S40), T35 (= T41), G36 (= G42), D51 (= D60), L52 (= L61), F73 (= F82), A74 (≠ S83), A75 (= A84), N92 (= N101), Y141 (= Y150), K145 (= K154), Y168 (= Y177), F169 (= F178), V171 (≠ A180), H184 (= H193)
- binding zinc ion: E182 (= E191), H184 (= H193), E187 (= E196), H189 (= H198)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
48% identity, 96% coverage: 8:347/356 of query aligns to 3:316/325 of 4twrA
- active site: S117 (≠ T126), C118 (≠ A127), A119 (= A128), Y141 (= Y150), K145 (= K154), H184 (= H193), H189 (= H198)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), F12 (≠ Y17), I13 (= I18), D32 (= D37), N33 (= N38), L34 (= L39), S35 (= S40), T36 (= T41), G37 (= G42), D51 (= D60), I52 (≠ L61), F73 (= F82), A74 (≠ S83), A75 (= A84), N92 (= N101), S115 (= S124), K145 (= K154), Y168 (= Y177), A171 (= A180), H184 (= H193)
- binding zinc ion: E182 (= E191), H184 (= H193), E187 (= E196), H189 (= H198)
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
43% identity, 97% coverage: 9:352/356 of query aligns to 5:363/370 of 1gy8C
- active site: S144 (≠ T126), A145 (= A127), A146 (= A128), Y170 (= Y150), K174 (= K154)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G12 (= G16), Y13 (= Y17), I14 (= I18), D34 (= D37), S35 (≠ N38), L36 (= L39), V37 (vs. gap), G38 (vs. gap), D77 (= D60), V78 (≠ L61), M100 (≠ F82), C101 (≠ S83), A102 (= A84), L104 (≠ S86), N119 (= N101), S142 (= S124), S143 (= S125), S144 (≠ T126), Y170 (= Y150), K174 (= K154), Y197 (= Y177), A200 (= A180)
- binding uridine-5'-diphosphate: N199 (= N179), H218 (= H198), L219 (= L199), I222 (≠ N202), M241 (≠ L214), P242 (≠ T215), I243 (≠ V216), F244 (= F217), C255 (= C228), R257 (= R230), R324 (= R313), D327 (= D316)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
43% identity, 97% coverage: 9:352/356 of query aligns to 5:359/366 of 2cnbA
- active site: S144 (≠ T126), A145 (= A127), A146 (= A128), Y169 (= Y150), K173 (= K154)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G12 (= G16), Y13 (= Y17), I14 (= I18), D34 (= D37), S35 (≠ N38), V37 (vs. gap), G38 (vs. gap), D77 (= D60), V78 (≠ L61), M100 (≠ F82), C101 (≠ S83), A102 (= A84), L104 (≠ S86), N119 (= N101), S143 (= S125), S144 (≠ T126), Y169 (= Y150), K173 (= K154), Y196 (= Y177), F197 (= F178), A199 (= A180)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ S86), S144 (≠ T126), Y169 (= Y150), F197 (= F178), N198 (= N179), H217 (= H198), L218 (= L199), P238 (≠ T215), I239 (≠ V216), F240 (= F217), C251 (= C228), R253 (= R230), V297 (= V290), R320 (= R313), D323 (= D316)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
39% identity, 97% coverage: 8:352/356 of query aligns to 3:327/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), Y12 (= Y17), I13 (= I18), D32 (= D37), N33 (= N38), S35 (= S40), G37 (= G42), D57 (= D60), L58 (= L61), F79 (= F82), A80 (≠ S83), I83 (≠ S86), N98 (= N101), Y147 (= Y150), K151 (= K154), Y175 (= Y177), N177 (= N179), V178 (≠ A180)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
40% identity, 97% coverage: 8:353/356 of query aligns to 4:339/348 of Q14376
- GYI 12:14 (= GYI 16:18) binding
- DNFHN 33:37 (≠ DNLST 37:41) binding
- N34 (= N38) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ DL 60:61) binding
- F88 (= F82) binding
- G90 (≠ A84) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ S86) binding
- V94 (= V88) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ L97) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (≠ T126) mutation to A: Loss of activity.
- SAT 132:134 (≠ TAA 126:128) binding
- Y157 (= Y150) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K154) binding
- A180 (≠ S172) to V: in dbSNP:rs3204468
- L183 (= L175) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y177) binding
- YFN 185:187 (= YFN 177:179) binding
- NNL 206:208 (≠ THL 197:199) binding
- NVF 224:226 (≠ TVF 215:217) binding
- R239 (= R230) binding
- K257 (= K248) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RDGD 313:316) binding
- C307 (≠ L320) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (= L326) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G332) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ A349) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
40% identity, 97% coverage: 8:353/356 of query aligns to 4:339/346 of 1ek6A
- active site: S132 (≠ T126), A133 (= A127), T134 (≠ A128), Y157 (= Y150), K161 (= K154)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G13), G12 (= G16), Y13 (= Y17), I14 (= I18), D33 (= D37), N34 (= N38), H36 (≠ S40), N37 (≠ T41), D66 (= D60), I67 (≠ L61), F88 (= F82), A89 (≠ S83), G90 (≠ A84), K92 (≠ S86), S130 (= S124), S131 (= S125), S132 (≠ T126), Y157 (= Y150), K161 (= K154), Y185 (= Y177), P188 (≠ A180)
- binding uridine-5'-diphosphate-glucose: S132 (≠ T126), Y157 (= Y150), F186 (= F178), N187 (= N179), N207 (≠ H198), L208 (= L199), N224 (≠ T215), V225 (= V216), F226 (= F217), R239 (= R230), Y241 (= Y232), V277 (= V290), R300 (= R313), D303 (= D316)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
40% identity, 97% coverage: 8:353/356 of query aligns to 3:338/345 of 1hzjA
- active site: S131 (≠ T126), A132 (= A127), T133 (≠ A128), Y156 (= Y150), K160 (= K154)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), Y12 (= Y17), I13 (= I18), D32 (= D37), N33 (= N38), H35 (≠ S40), N36 (≠ T41), D65 (= D60), I66 (≠ L61), F87 (= F82), A88 (≠ S83), G89 (≠ A84), K91 (≠ S86), S129 (= S124), S131 (≠ T126), Y156 (= Y150), K160 (= K154), Y184 (= Y177), P187 (≠ A180)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N179), N206 (≠ H198), L207 (= L199), N223 (≠ T215), V224 (= V216), F225 (= F217), R238 (= R230), Y240 (= Y232), V276 (= V290), R299 (= R313), D302 (= D316)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
40% identity, 97% coverage: 8:353/356 of query aligns to 3:338/347 of 1i3lA
- active site: S131 (≠ T126), A132 (= A127), T133 (≠ A128), Y156 (= Y150), K160 (= K154)
- binding galactose-uridine-5'-diphosphate: N186 (= N179), N206 (≠ H198), L207 (= L199), N223 (≠ T215), V224 (= V216), F225 (= F217), R238 (= R230), Y240 (= Y232), V276 (= V290), R299 (= R313), D302 (= D316)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), Y12 (= Y17), I13 (= I18), D32 (= D37), N33 (= N38), H35 (≠ S40), N36 (≠ T41), D65 (= D60), I66 (≠ L61), F87 (= F82), A88 (≠ S83), G89 (≠ A84), K91 (≠ S86), S129 (= S124), S130 (= S125), S131 (≠ T126), Y156 (= Y150), K160 (= K154), Y184 (= Y177), P187 (≠ A180)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
40% identity, 97% coverage: 8:353/356 of query aligns to 3:338/347 of 1i3kA
- active site: S131 (≠ T126), A132 (= A127), T133 (≠ A128), Y156 (= Y150), K160 (= K154)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), Y12 (= Y17), I13 (= I18), D32 (= D37), N33 (= N38), H35 (≠ S40), N36 (≠ T41), D65 (= D60), I66 (≠ L61), F87 (= F82), A88 (≠ S83), G89 (≠ A84), K91 (≠ S86), S129 (= S124), S131 (≠ T126), Y156 (= Y150), K160 (= K154), Y184 (= Y177), P187 (≠ A180)
- binding uridine-5'-diphosphate-glucose: F185 (= F178), N186 (= N179), N206 (≠ H198), L207 (= L199), N223 (≠ T215), V224 (= V216), F225 (= F217), R238 (= R230), Y240 (= Y232), V276 (= V290), R299 (= R313), D302 (= D316)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 98% coverage: 3:352/356 of query aligns to 67:403/419 of Q9SA77
- G275 (vs. gap) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R230) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
42% identity, 97% coverage: 8:352/356 of query aligns to 4:331/336 of 7kn1A
- active site: S126 (≠ T126), Y150 (= Y150), K154 (= K154)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G12 (= G16), Y13 (= Y17), I14 (= I18), D33 (= D37), S34 (≠ N38), C36 (≠ S40), N37 (≠ T41), D60 (= D60), I61 (≠ L61), F82 (= F82), A83 (≠ S83), A84 (= A84), K86 (≠ S86), S124 (= S124), S125 (= S125), S126 (≠ T126), Y150 (= Y150), K154 (= K154), Y178 (= Y177), P181 (≠ A180)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V88), S126 (≠ T126), Y150 (= Y150), N180 (= N179), S199 (≠ T197), N200 (≠ H198), L201 (= L199), Q217 (≠ T215), V218 (= V216), F219 (= F217), R232 (= R230), Y234 (= Y232), V270 (= V290), R293 (= R313), D296 (= D316)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
39% identity, 98% coverage: 9:356/356 of query aligns to 4:340/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), Y12 (= Y17), I13 (= I18), D32 (= D37), N33 (= N38), N36 (≠ T41), D62 (= D60), L63 (= L61), F84 (= F82), A85 (≠ S83), G86 (≠ A84), K88 (≠ S86), N103 (= N101), S126 (= S124), S128 (≠ T126), Y152 (= Y150), K156 (= K154), Y180 (= Y177), P183 (≠ A180)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N179), N202 (≠ H198), L203 (= L199), T219 (= T215), Y221 (≠ F217), R234 (= R230), Y236 (= Y232), V275 (= V290), R298 (= R313), D301 (= D316)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
39% identity, 98% coverage: 9:356/356 of query aligns to 4:340/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G11 (= G16), Y12 (= Y17), I13 (= I18), D32 (= D37), N33 (= N38), N36 (≠ T41), D62 (= D60), L63 (= L61), F84 (= F82), A85 (≠ S83), G86 (≠ A84), K88 (≠ S86), N103 (= N101), S126 (= S124), S128 (≠ T126), Y152 (= Y150), K156 (= K154), Y180 (= Y177), P183 (≠ A180)
- binding uridine-5'-diphosphate-glucose: S128 (≠ T126), A129 (= A127), F181 (= F178), N182 (= N179), N202 (≠ H198), L203 (= L199), T219 (= T215), V220 (= V216), Y221 (≠ F217), R234 (= R230), Y236 (= Y232), V275 (= V290), R298 (= R313), D301 (= D316)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
39% identity, 96% coverage: 9:351/356 of query aligns to 3:329/338 of 2udpA
- active site: S124 (≠ T126), A125 (= A127), T126 (≠ A128), Y149 (= Y150), K153 (= K154), M189 (≠ I189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), Y11 (= Y17), I12 (= I18), D31 (= D37), N32 (= N38), L33 (= L39), C34 (≠ S40), N35 (≠ T41), S36 (≠ G42), D58 (= D60), I59 (≠ L61), F80 (= F82), A81 (≠ S83), G82 (≠ A84), K84 (≠ S86), S122 (= S124), S124 (≠ T126), Y149 (= Y150), K153 (= K154), Y177 (= Y177)
- binding phenyl-uridine-5'-diphosphate: N179 (= N179), N199 (≠ H198), L200 (= L199), A216 (≠ T215), I217 (≠ V216), F218 (= F217), R231 (= R230), Y233 (= Y232), V269 (= V290), R292 (= R313), D295 (= D316)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
39% identity, 96% coverage: 9:351/356 of query aligns to 3:329/338 of 1udcA
- active site: S124 (≠ T126), A125 (= A127), T126 (≠ A128), Y149 (= Y150), K153 (= K154), M189 (≠ I189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), Y11 (= Y17), I12 (= I18), D31 (= D37), N32 (= N38), C34 (≠ S40), N35 (≠ T41), S36 (≠ G42), D58 (= D60), I59 (≠ L61), F80 (= F82), A81 (≠ S83), G82 (≠ A84), K84 (≠ S86), S122 (= S124), Y149 (= Y150), K153 (= K154), Y177 (= Y177), P180 (≠ A180)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A128), Y149 (= Y150), N179 (= N179), N199 (≠ H198), L200 (= L199), L215 (= L214), A216 (≠ T215), I217 (≠ V216), F218 (= F217), R231 (= R230), Y233 (= Y232), V269 (= V290), R292 (= R313)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
39% identity, 96% coverage: 9:351/356 of query aligns to 3:329/338 of P09147
- YI 11:12 (= YI 17:18) binding
- DNLCNS 31:36 (≠ DNLSTG 37:42) binding
- DI 58:59 (≠ DL 60:61) binding
- FAGLK 80:84 (≠ FSARS 82:86) binding
- N99 (= N101) binding
- S124 (≠ T126) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y150) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K154) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F178) binding
- Y299 (≠ L320) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
39% identity, 96% coverage: 9:351/356 of query aligns to 3:329/338 of 1udaA
- active site: S124 (≠ T126), A125 (= A127), T126 (≠ A128), Y149 (= Y150), K153 (= K154), M189 (≠ I189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), Y11 (= Y17), I12 (= I18), D31 (= D37), N32 (= N38), L33 (= L39), C34 (≠ S40), N35 (≠ T41), S36 (≠ G42), D58 (= D60), I59 (≠ L61), F80 (= F82), A81 (≠ S83), G82 (≠ A84), K84 (≠ S86), S122 (= S124), Y149 (= Y150), K153 (= K154), Y177 (= Y177), P180 (≠ A180)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A128), N179 (= N179), N199 (≠ H198), L200 (= L199), A216 (≠ T215), I217 (≠ V216), F218 (= F217), R231 (= R230), Y233 (= Y232), R292 (= R313), D295 (= D316), Y299 (≠ L320)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
39% identity, 96% coverage: 9:351/356 of query aligns to 3:329/338 of 1naiA
- active site: S124 (≠ T126), A125 (= A127), T126 (≠ A128), Y149 (= Y150), K153 (= K154), M189 (≠ I189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), Y11 (= Y17), I12 (= I18), D31 (= D37), N32 (= N38), L33 (= L39), C34 (≠ S40), N35 (≠ T41), S36 (≠ G42), D58 (= D60), I59 (≠ L61), F80 (= F82), A81 (≠ S83), G82 (≠ A84), K84 (≠ S86), Y149 (= Y150), K153 (= K154), Y177 (= Y177), P180 (≠ A180)
- binding 1,3-propandiol: N35 (≠ T41), K84 (≠ S86), E191 (= E191), P193 (vs. gap)
- binding uridine-5'-diphosphate: N179 (= N179), N199 (≠ H198), L200 (= L199), L215 (= L214), A216 (≠ T215), R231 (= R230), Y233 (= Y232), R292 (= R313)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
39% identity, 96% coverage: 9:351/356 of query aligns to 3:329/338 of 1lrjA
- active site: S124 (≠ T126), A125 (= A127), T126 (≠ A128), Y149 (= Y150), K153 (= K154), M189 (≠ I189)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G10 (= G16), Y11 (= Y17), I12 (= I18), D31 (= D37), N32 (= N38), L33 (= L39), C34 (≠ S40), N35 (≠ T41), S36 (≠ G42), D58 (= D60), I59 (≠ L61), F80 (= F82), A81 (≠ S83), G82 (≠ A84), K84 (≠ S86), Y149 (= Y150), K153 (= K154), Y177 (= Y177), P180 (≠ A180)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V88), S124 (≠ T126), F178 (= F178), N179 (= N179), L200 (= L199), L215 (= L214), A216 (≠ T215), F218 (= F217), R231 (= R230), Y233 (= Y232), V269 (= V290), R292 (= R313), D295 (= D316)
Query Sequence
>8499360 FitnessBrowser__Miya:8499360
MGETPICNVLVCGGAGYIGSHMVRALVARGCTPVIFDNLSTGHADAVDAAAPDCDLVRGD
LLDRQTLRRVFAEHSFDAVMHFSARSLVGESVREPALYYANNVTGTLNLLDAMREAGVLR
LVFSSTAAVYGNPVTERIAETHPLAPVNPYGASKLMVERMLADHATAYGLRSVALRYFNA
AGADRAGGIGESHSPETHLIPNILRAVLGTGPALTVFGSDYDTPDGTCVRDYIHVNDLCD
AHLAALDKLLAAPVGTAALKDGLTKDGLAAEPGGKVALHYNLGNGLGFTVRQVIDAAARV
TGREVPYTVGPRRDGDPARLVADSTLAGRELGWTPKVADIREIIETAWAWHRDQKY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory