SitesBLAST
Comparing 8499364 FitnessBrowser__Miya:8499364 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
49% identity, 100% coverage: 2:340/340 of query aligns to 3:351/355 of P27830
- FI 12:13 (= FI 11:12) binding
- DKLT 33:36 (= DKLT 33:36) binding
- DI 59:60 (= DI 62:63) binding
- T100 (= T103) binding
- D135 (= D129) active site, Proton donor
- E136 (= E130) active site, Proton acceptor
- Y160 (= Y153) active site, Proton acceptor
- YSASK 160:164 (= YSASK 153:157) binding
- N190 (= N183) binding
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
49% identity, 94% coverage: 1:319/340 of query aligns to 2:306/311 of 6bi4C
- active site: T117 (= T128), D118 (= D129), E119 (= E130), Y142 (= Y153), K146 (= K157)
- binding beta-D-fructofuranose: Q62 (≠ A64), N63 (≠ D65), G64 (≠ A66), E65 (≠ D67)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D33), A35 (≠ K34), L36 (= L35), T37 (= T36), S39 (≠ A38), G40 (= G39), E60 (≠ D62), I61 (= I63), Q62 (≠ A64), F82 (= F84), A83 (= A85), A84 (= A86), T92 (= T103), V115 (= V126), T117 (= T128), Y142 (= Y153), K146 (= K157), C169 (= C180), S170 (= S181)
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
47% identity, 100% coverage: 1:339/340 of query aligns to 1:360/361 of 1kewA
- active site: T133 (= T128), D134 (= D129), E135 (= E130), L152 (vs. gap), L154 (vs. gap), F155 (= F141), T158 (≠ S144), Y167 (= Y153), K171 (= K157)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D33), K33 (= K34), L34 (= L35), T35 (= T36), A37 (= A38), G38 (= G39), D58 (= D62), I59 (= I63), L80 (≠ F84), A81 (= A85), A82 (= A86), S84 (≠ T88), T99 (= T103), I131 (≠ V126), S132 (= S127), T133 (= T128), Y167 (= Y153), K171 (= K157), C194 (= C180), N196 (= N182), N197 (= N183)
- binding thymidine-5'-diphosphate: E135 (= E130), N196 (= N182), K206 (= K192), L207 (= L193), P222 (= P208), Y224 (= Y210), R231 (= R217), N266 (= N252), R297 (= R276), H300 (= H279), Y357 (= Y336)
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
47% identity, 100% coverage: 1:339/340 of query aligns to 1:360/361 of 1keuA
- active site: T133 (= T128), D134 (= D129), E135 (= E130), L152 (vs. gap), L154 (vs. gap), F155 (= F141), T158 (≠ S144), Y167 (= Y153), K171 (= K157)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (≠ T88), T133 (= T128), D134 (= D129), E135 (= E130), Y167 (= Y153), N196 (= N182), K206 (= K192), L207 (= L193), P222 (= P208), Y224 (= Y210), R231 (= R217), N266 (= N252), R297 (= R276), H300 (= H279), Y357 (= Y336)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D33), K33 (= K34), L34 (= L35), T35 (= T36), G38 (= G39), D58 (= D62), L80 (≠ F84), A81 (= A85), A82 (= A86), S84 (≠ T88), T99 (= T103), S132 (= S127), T133 (= T128), Y167 (= Y153), K171 (= K157), C194 (= C180), N196 (= N182), N197 (= N183)
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
47% identity, 100% coverage: 1:339/340 of query aligns to 1:360/361 of P26391
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
49% identity, 94% coverage: 1:319/340 of query aligns to 2:305/310 of 6bi4B
- active site: T117 (= T128), D118 (= D129), E119 (= E130), Y142 (= Y153), K146 (= K157)
- binding alpha-D-glucopyranose: Q62 (≠ A64), N63 (≠ D65)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D33), A35 (≠ K34), L36 (= L35), T37 (= T36), S39 (≠ A38), G40 (= G39), E60 (≠ D62), F82 (= F84), A83 (= A85), A84 (= A86), T92 (= T103), S116 (= S127), T117 (= T128), Y142 (= Y153), K146 (= K157), C169 (= C180)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
55% identity, 94% coverage: 1:321/340 of query aligns to 1:319/322 of 1r66A
- active site: T127 (= T128), D128 (= D129), E129 (= E130), Y151 (= Y153), K155 (= K157)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D33), S38 (≠ K34), L39 (= L35), T40 (= T36), G43 (= G39), D63 (= D62), I64 (= I63), F83 (= F84), A84 (= A85), A85 (= A86), S87 (≠ T88), T102 (= T103), V125 (= V126), S126 (= S127), Y151 (= Y153), K155 (= K157), N181 (= N183)
- binding thymidine-5'-diphosphate: H88 (= H89), E129 (= E130), N180 (= N182), K190 (= K192), L191 (= L193), P206 (= P208), Y208 (= Y210), R215 (= R217), N250 (= N252), R274 (= R276), H277 (= H279)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
46% identity, 99% coverage: 2:337/340 of query aligns to 5:361/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D33), A37 (≠ K34), L38 (= L35), T39 (= T36), G42 (= G39), D62 (= D62), I63 (= I63), L84 (≠ F84), A85 (= A85), A86 (= A86), T103 (= T103), S143 (= S127), T144 (= T128), Y169 (= Y153), K173 (= K157), C196 (= C180)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
54% identity, 94% coverage: 1:321/340 of query aligns to 1:319/322 of 1r6dA
- active site: T127 (= T128), N128 (≠ D129), Q129 (≠ E130), Y151 (= Y153), K155 (= K157)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ T88), H88 (= H89), T127 (= T128), N128 (≠ D129), Q129 (≠ E130), Y151 (= Y153), N180 (= N182), K190 (= K192), L191 (= L193), P206 (= P208), Y208 (= Y210), R215 (= R217), N250 (= N252), R274 (= R276), H277 (= H279), Y281 (= Y283)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D33), S38 (≠ K34), L39 (= L35), T40 (= T36), A42 (= A38), G43 (= G39), D63 (= D62), I64 (= I63), F83 (= F84), A84 (= A85), A85 (= A86), S87 (≠ T88), T102 (= T103), V125 (= V126), S126 (= S127), Y151 (= Y153), K155 (= K157), N181 (= N183)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
50% identity, 94% coverage: 1:319/340 of query aligns to 2:312/329 of 2hunA
- active site: T125 (= T128), D126 (= D129), E127 (= E130), Y149 (= Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D33), K35 (= K34), S40 (≠ G39), D60 (= D62), V61 (≠ I63), L80 (≠ F84), A81 (= A85), A82 (= A86), S99 (≠ T103), T125 (= T128), K153 (= K157), C176 (= C180), T177 (≠ S181), N178 (= N182), N179 (= N183)
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
48% identity, 96% coverage: 2:329/340 of query aligns to 3:341/344 of 1bxkB
- active site: S125 (≠ G119), T134 (= T128), D135 (= D129), E136 (= E130), S158 (= S151), Y160 (= Y153), S161 (= S154), K164 (= K157)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D33 (= D33), K34 (= K34), L35 (= L35), T36 (= T36), A38 (= A38), G39 (= G39), D59 (= D62), I60 (= I63), L81 (≠ F84), A83 (= A86), T100 (= T103), I132 (≠ V126), S133 (= S127), T134 (= T128), K164 (= K157), C187 (= C180)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
52% identity, 94% coverage: 2:321/340 of query aligns to 9:323/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G10), F18 (= F11), I19 (= I12), D44 (= D33), S45 (≠ K34), L46 (= L35), T47 (= T36), G50 (= G39), D68 (= D62), I69 (= I63), F88 (= F84), A89 (= A85), A90 (= A86), T92 (= T88), T107 (= T103), V130 (= V126), Y156 (= Y153), K160 (= K157), G184 (≠ S181), N186 (= N183)
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
52% identity, 94% coverage: 2:321/340 of query aligns to 8:322/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G10), F17 (= F11), I18 (= I12), D43 (= D33), S44 (≠ K34), L45 (= L35), T46 (= T36), G49 (= G39), D67 (= D62), F87 (= F84), A88 (= A85), A89 (= A86), T91 (= T88), T106 (= T103), V129 (= V126), S130 (= S127), T131 (= T128), Y155 (= Y153), K159 (= K157)
- binding thymidine-5'-diphosphate: E133 (= E130), N184 (= N182), K194 (= K192), V195 (≠ L193), P210 (= P208), Y212 (= Y210), R219 (= R217), N254 (= N252), R278 (= R276), H281 (= H279)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
48% identity, 94% coverage: 2:322/340 of query aligns to 5:330/347 of 1kerB
- active site: T124 (= T128), D125 (= D129), E126 (= E130), Y160 (= Y153), K164 (= K157)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (≠ T88), N87 (≠ V90), T124 (= T128), D125 (= D129), E126 (= E130), Y160 (= Y153), N189 (= N182), K199 (= K192), F200 (≠ L193), R203 (≠ L196), Q204 (≠ M197), K215 (≠ P208), L216 (≠ V209), Y217 (= Y210), R224 (= R217), N259 (= N252), R283 (= R276), H286 (= H279)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D33), K37 (= K34), L38 (= L35), T39 (= T36), G42 (= G39), D61 (= D62), I62 (= I63), Y81 (≠ F84), A82 (= A85), A83 (= A86), S85 (≠ T88), T100 (= T103), S123 (= S127), T124 (= T128), Y160 (= Y153), K164 (= K157), C187 (= C180), N190 (= N183)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
48% identity, 94% coverage: 2:322/340 of query aligns to 4:329/346 of 1ketA
- active site: T123 (= T128), D124 (= D129), E125 (= E130), Y159 (= Y153), K163 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D33), K36 (= K34), L37 (= L35), T38 (= T36), A40 (= A38), G41 (= G39), D60 (= D62), I61 (= I63), Y80 (≠ F84), A82 (= A86), S84 (≠ T88), T99 (= T103), S122 (= S127), T123 (= T128), Y159 (= Y153), K163 (= K157)
- binding thymidine-5'-diphosphate: E125 (= E130), N188 (= N182), F199 (≠ L193), R202 (≠ L196), Q203 (≠ M197), K214 (≠ P208), Y216 (= Y210), R223 (= R217), N258 (= N252), R282 (= R276), H285 (= H279)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
48% identity, 94% coverage: 2:322/340 of query aligns to 4:329/346 of 1kepA
- active site: T123 (= T128), D124 (= D129), E125 (= E130), Y159 (= Y153), K163 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D33), K36 (= K34), L37 (= L35), T38 (= T36), G41 (= G39), D60 (= D62), I61 (= I63), Y80 (≠ F84), A81 (= A85), A82 (= A86), S84 (≠ T88), T99 (= T103), S122 (= S127), Y159 (= Y153), K163 (= K157), N189 (= N183)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (≠ T88), T123 (= T128), E125 (= E130), Y159 (= Y153), N188 (= N182), K198 (= K192), R223 (= R217), R282 (= R276)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
46% identity, 94% coverage: 2:322/340 of query aligns to 6:331/348 of P95780
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
40% identity, 96% coverage: 3:327/340 of query aligns to 11:334/667 of Q9LPG6
- G18 (= G10) mutation to A: Abolishes dehydratase activity.
- K36 (≠ T28) mutation to A: Reduces dehydratase activity.
- D96 (= D91) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K157) mutation to A: Abolishes dehydratase activity.
- G193 (= G185) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
40% identity, 96% coverage: 3:327/340 of query aligns to 9:332/669 of Q9SYM5
- R283 (= R276) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
35% identity, 93% coverage: 2:316/340 of query aligns to 5:315/319 of 6vloA
- active site: T126 (= T128), D127 (= D129), E128 (= E130), Y151 (= Y153), K155 (= K157)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D33), I37 (≠ K34), A42 (= A45), D59 (= D62), I60 (= I63), F81 (= F84), A82 (= A85), A83 (= A86), S85 (≠ T88), M124 (≠ V126), T126 (= T128), K155 (= K157)
- binding thymidine-5'-diphosphate: N180 (= N182), K190 (= K192), L191 (= L193), K194 (≠ L196), H206 (≠ P208), Q208 (≠ Y210), R215 (= R217), V250 (≠ N252), R275 (= R276), R281 (= R282)
Query Sequence
>8499364 FitnessBrowser__Miya:8499364
MRLLVTGGCGFIGTNFVRLVIDRRPDVTVVNLDKLTYAGNPLNLADVEKTHGGTRYFFEH
ADIADADAVRRILAQHRIDAVVNFAAETHVDRSIDDPAPFVVTNVLGTQTLLTAAREAGV
TRFVHVSTDEVYGTLGPEGRFTESTPLAPNSPYSASKAAGDLMARAWFETYGYPVVITRC
SNNYGPYQFPEKLIPLMIGRAGRDETLPVYGDGMNVRDWIHVDDHCRGVLLALEKGRPGA
VYNFGGAAERPNIKVVRAILRLVGKPESLIRHVTDRPGHDRRYAMDFSLAAQELGYTPEY
DFERGLAETVAWYRNNAAWLESVASGAYREFMQRWYGERL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory