SitesBLAST
Comparing 8499376 FitnessBrowser__Miya:8499376 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
47% identity, 99% coverage: 4:560/562 of query aligns to 92:655/664 of P09114
- P191 (= P102) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W480) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
47% identity, 99% coverage: 4:560/562 of query aligns to 95:658/667 of P09342
- C161 (= C69) modified: Disulfide link with 307
- P194 (= P102) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V213) modified: Disulfide link with 161
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
46% identity, 99% coverage: 4:560/562 of query aligns to 98:661/670 of P17597
- A122 (= A28) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ I30) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E49) binding
- S186 (= S91) binding
- P197 (= P102) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ P104) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q112) binding
- K220 (= K125) binding
- R246 (= R151) binding ; binding
- K256 (= K161) binding
- G308 (= G211) binding
- TL 331:332 (= TL 236:237) binding
- C340 (≠ G245) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ IGMH 254:257) binding
- GVRFD 371:375 (≠ GARFD 276:280) binding
- DR 376:377 (= DR 281:282) binding
- DI 395:396 (= DI 300:301) binding
- DV 414:415 (≠ DC 319:320) binding
- QH 487:488 (≠ QN 393:394) binding
- GG 508:509 (= GG 414:415) binding
- GAM 511:513 (≠ GTM 417:419) binding
- D538 (= D444) binding
- DGS 538:540 (= DGS 444:446) binding
- N565 (= N471) binding
- NQHLGM 565:570 (≠ NGYLGM 471:476) binding
- H567 (≠ Y473) binding
- W574 (= W480) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ A552) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), G426 (= G417), M428 (= M419), G452 (= G443), D453 (= D444), G454 (= G445), S455 (= S446), M458 (= M449), N480 (= N471), H482 (≠ Y473), L483 (= L474), G484 (= G475), M485 (= M476), V486 (= V477)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414)
- binding magnesium ion: F370 (≠ Y362), D453 (= D444), M458 (= M449), Q461 (= Q452), N480 (= N471), H482 (≠ Y473), K533 (≠ A517)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M256), R292 (= R282), M485 (= M476), W489 (= W480), S568 (≠ A552)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 5wj1A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (≠ I254), G286 (= G276), R288 (= R278), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M256), D291 (= D281), R292 (= R282), M485 (= M476), W489 (= W480), S568 (≠ A552)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), M458 (= M449), N480 (= N471), H482 (≠ Y473), L483 (= L474), G484 (= G475), M485 (= M476), V486 (= V477)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 5k6tA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H257), R292 (= R282), M485 (= M476), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), G286 (= G276), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), Q404 (= Q395), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), G426 (= G417), M428 (= M419), G452 (= G443), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ Y473), L483 (= L474), G484 (= G475)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 5k6rA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R282), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), M266 (= M256), G286 (= G276), R288 (= R278), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), G426 (= G417), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), M458 (= M449), N480 (= N471), H482 (≠ Y473), L483 (= L474), G484 (= G475), M485 (= M476), V486 (= V477)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 1z8nA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K125), R161 (= R151), Y191 (= Y181), R194 (≠ T184), D291 (= D281), R292 (= R282), D312 (= D302), W489 (= W480), G569 (= G553)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471)
- binding thiamine diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), G426 (= G417), M428 (= M419), G452 (= G443), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ Y473), L483 (= L474), G484 (= G475), M485 (= M476), V486 (= V477)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 1yi1A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D281), R292 (= R282), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (≠ I254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 1yi0A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 1yhzA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D281), R292 (= R282), M485 (= M476), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), Q404 (= Q395), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 1yhyA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), V486 (= V477), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), Q404 (= Q395), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 1ybhA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M256), D291 (= D281), R292 (= R282), M485 (= M476), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), Q404 (= Q395), M405 (= M396), G423 (= G414), G424 (= G415)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/583 of 5k3sA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R282), M485 (= M476), W489 (= W480), G569 (= G553)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), M266 (= M256), G286 (= G276), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), G426 (= G417), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ Y473), L483 (= L474), G484 (= G475), M485 (= M476), V486 (= V477)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
46% identity, 99% coverage: 4:560/562 of query aligns to 13:576/585 of 5k2oA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), M266 (= M256), V293 (= V283), V400 (= V391), G426 (= G417), M428 (= M419), D453 (= D444), N480 (= N471), H482 (≠ Y473), L483 (= L474), M485 (= M476), V486 (= V477), W489 (= W480), H558 (≠ R542)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M256), R292 (= R282), W489 (= W480), S568 (≠ A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), L264 (≠ I254), G286 (= G276), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), Q404 (= Q395), M405 (= M396), G423 (= G414)
- binding magnesium ion: D453 (= D444), N480 (= N471), H482 (≠ Y473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), M428 (= M419), D453 (= D444), G454 (= G445), S455 (= S446), N480 (= N471), H482 (≠ Y473), L483 (= L474), G484 (= G475), M485 (= M476), V486 (= V477)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
45% identity, 99% coverage: 4:560/562 of query aligns to 12:575/582 of 3ea4A
- active site: Y32 (= Y24), G34 (= G26), G35 (= G27), A36 (= A28), S37 (≠ V29), E58 (= E49), T81 (= T72), F120 (= F111), Q121 (= Q112), E122 (= E113), K170 (= K161), M265 (= M256), V292 (= V283), V399 (= V391), G425 (= G417), M427 (= M419), D452 (= D444), N479 (= N471), H481 (≠ Y473), L482 (= L474), M484 (= M476), V485 (= V477), W488 (= W480), H557 (≠ R542)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D281), R291 (= R282), W488 (= W480), S567 (≠ A552)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R151), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (= M238), L263 (≠ I254), G264 (= G255), M265 (= M256), H266 (= H257), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ C320), M404 (= M396), G422 (= G414)
- binding magnesium ion: D452 (= D444), N479 (= N471), H481 (≠ Y473)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V391), G400 (= G392), Q401 (= Q393), H402 (≠ N394), M427 (= M419), G451 (= G443), D452 (= D444), G453 (= G445), S454 (= S446), N479 (= N471), H481 (≠ Y473), L482 (= L474), G483 (= G475), M484 (= M476), V485 (= V477)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
45% identity, 99% coverage: 4:560/562 of query aligns to 12:575/582 of 3e9yA
- active site: Y32 (= Y24), G34 (= G26), G35 (= G27), A36 (= A28), S37 (≠ V29), E58 (= E49), T81 (= T72), F120 (= F111), Q121 (= Q112), E122 (= E113), K170 (= K161), M265 (= M256), V292 (= V283), V399 (= V391), G425 (= G417), M427 (= M419), D452 (= D444), N479 (= N471), H481 (≠ Y473), L482 (= L474), M484 (= M476), V485 (= V477), W488 (= W480), H557 (≠ R542)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D281), R291 (= R282), W488 (= W480), S567 (≠ A552)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R151), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (= M238), L263 (≠ I254), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ C320), M404 (= M396), G422 (= G414)
- binding magnesium ion: D452 (= D444), N479 (= N471), H481 (≠ Y473)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V391), G400 (= G392), Q401 (= Q393), H402 (≠ N394), M427 (= M419), G451 (= G443), G453 (= G445), S454 (= S446), N479 (= N471), H481 (≠ Y473), L482 (= L474), G483 (= G475), M484 (= M476), V485 (= V477)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
45% identity, 99% coverage: 4:560/562 of query aligns to 13:576/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M256), R292 (= R282), W489 (= W480), S568 (≠ A552)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V391), G401 (= G392), Q402 (= Q393), H403 (≠ N394), G426 (= G417), M428 (= M419), G452 (= G443), D453 (= D444), G454 (= G445), S455 (= S446), L483 (= L474), G484 (= G475), M485 (= M476), V486 (= V477)
- binding flavin-adenine dinucleotide: R161 (= R151), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (= M238), M263 (= M253), L264 (≠ I254), M266 (= M256), H267 (= H257), G286 (= G276), R288 (= R278), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ C320), M405 (= M396), G423 (= G414)
- binding magnesium ion: A37 (= A28), T82 (= T72), S83 (= S73), Q122 (= Q112), Y381 (≠ Q372), D453 (= D444), M458 (= M449), Q461 (= Q452), N480 (= N471), H482 (≠ Y473), K533 (≠ A517)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
46% identity, 99% coverage: 3:561/562 of query aligns to 14:580/601 of 6deqA
- active site: Y35 (= Y24), G37 (= G26), G38 (= G27), A39 (= A28), I40 (≠ V29), E61 (= E49), T84 (= T72), F123 (= F111), Q124 (= Q112), E125 (= E113), K173 (= K161), K232 (≠ E221), M268 (= M256), V295 (= V283), V411 (= V391), L436 (= L416), G437 (= G417), M439 (= M419), D464 (= D444), N491 (= N471), E493 (≠ Y473), Q494 (≠ L474), M496 (= M476), V497 (= V477), W500 (= W480), L522 (= L503), N527 (≠ G508), V528 (≠ A509)
- binding flavin-adenine dinucleotide: R163 (= R151), G221 (= G210), A222 (≠ G211), G223 (= G212), N226 (≠ M215), T248 (= T236), L249 (= L237), Q250 (≠ M238), L266 (≠ I254), G288 (= G276), A289 (= A277), R290 (= R278), D292 (= D280), R294 (= R282), V295 (= V283), E321 (≠ D300), I322 (= I301), D340 (= D319), V341 (≠ C320), M416 (= M396), G434 (= G414)
- binding magnesium ion: D464 (= D444), N491 (= N471), E493 (≠ Y473)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M256), R294 (= R282), M496 (= M476), V497 (= V477), W500 (= W480), A571 (= A552)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V391), G412 (= G392), Q413 (= Q393), H414 (≠ N394), M439 (= M419), G463 (= G443), D464 (= D444), A465 (≠ G445), S466 (= S446), N491 (= N471), E493 (≠ Y473), Q494 (≠ L474), G495 (= G475), M496 (= M476), V497 (= V477)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
46% identity, 99% coverage: 3:561/562 of query aligns to 12:576/597 of 6demA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), I38 (≠ V29), E59 (= E49), T82 (= T72), F121 (= F111), Q122 (= Q112), E123 (= E113), K171 (= K161), K228 (≠ E221), M264 (= M256), V291 (= V283), V407 (= V391), L432 (= L416), G433 (= G417), M435 (= M419), D460 (= D444), N487 (= N471), E489 (≠ Y473), Q490 (≠ L474), M492 (= M476), V493 (= V477), W496 (= W480), L518 (= L503), N523 (≠ G508), V524 (≠ A509)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M256), D289 (= D281), R290 (= R282), M492 (= M476), W496 (= W480), A567 (= A552)
- binding flavin-adenine dinucleotide: R161 (= R151), G217 (= G210), A218 (≠ G211), G219 (= G212), N222 (≠ M215), T244 (= T236), L245 (= L237), Q246 (≠ M238), L262 (≠ I254), G284 (= G276), A285 (= A277), R286 (= R278), D288 (= D280), R290 (= R282), V291 (= V283), E317 (≠ D300), I318 (= I301), N322 (≠ S305), D336 (= D319), V337 (≠ C320), M412 (= M396), G430 (= G414)
- binding magnesium ion: D460 (= D444), N487 (= N471), E489 (≠ Y473)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V391), G408 (= G392), Q409 (= Q393), H410 (≠ N394), M435 (= M419), G459 (= G443), D460 (= D444), A461 (≠ G445), S462 (= S446), M465 (= M449), N487 (= N471), E489 (≠ Y473), Q490 (≠ L474), G491 (= G475), M492 (= M476), V493 (= V477)
Query Sequence
>8499376 FitnessBrowser__Miya:8499376
MELNGARILLECLKREGVDVLFGYPGGAVIDIYDELPRHDIRHILVRHEQAAVHAADGFA
RASGKVGVCLVTSGPGATNTVTGIATAYADSIPMVVLTGQVPTPLIGNDAFQEVDIVGIT
RPCTKHNYLVKDVRDLARVLRQAFYLARSGRPGPVLVDLPKDVMQAKTEFVWPEDVKLRS
YNPTYRPNLNQLRRAVEALIEAKRPLFFAGGGVIMSDASEELGWLARTLSIPVTSTLMGL
GAFPGDDPLWLGMIGMHGTYAGNKAVNNADCIVAVGARFDDRVTGRLSAFASGARIIHID
IDPTSIRKNVQVDIPVVGDCRKALAGIREIATTRLAEKDWATAHEPWLTQVSAWRTEQPL
TYVKNGSIKPQQVVETIFSITRGDAIVTTEVGQNQMWTAQFFTFRKPRTLLTSGGLGTMG
YGFPAAIGAQFAFPDKLVIDMAGDGSIQMNIQELATAVCNKLPIKIVILNNGYLGMVRQW
QELFYQRNYCSTCMEAQPDFVKLAEAYGAEGYRITEAGELESTLRAAFASPHTAVIDVRV
EREENVYPMVPAGAALDEMLLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory