SitesBLAST
Comparing 8499412 FitnessBrowser__Miya:8499412 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q96XT4 2-oxoacid:ferredoxin oxidoreductase 2, subunit beta; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
40% identity, 93% coverage: 14:275/283 of query aligns to 11:290/304 of Q96XT4
5b46B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
40% identity, 93% coverage: 14:275/283 of query aligns to 8:287/301 of 5b46B
- binding magnesium ion: D87 (= D91), N115 (= N119), V117 (≠ I121)
- binding iron/sulfur cluster: W8 (= W14), C9 (= C15), C12 (= C18), C43 (≠ Q49), C194 (= C198), T196 (≠ S200), Y197 (≠ F201)
- binding thiamine diphosphate: I41 (= I47), G42 (= G48), C43 (≠ Q49), S44 (≠ A50), H62 (= H66), G86 (= G90), G88 (= G92), D89 (≠ C93), N115 (= N119), V117 (≠ I121), Y118 (= Y122), G119 (= G123), L120 (= L124), T121 (= T125)
P72579 2-oxoacid:ferredoxin oxidoreductase subunit beta; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see paper)
44% identity, 83% coverage: 14:249/283 of query aligns to 11:259/305 of P72579
- K49 (= K52) mutation to I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to R: Increase the oxidoreductase activity with pyruvate.; mutation to V: Slight decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.
- L123 (= L124) mutation L->A,I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to N: Strong decrease of the oxidoreductase activity with pyruvate and 2-oxobutyrate. However, this mutant shows almost the same activity with 2-oxoglutarate as the wild-type.
Q96Y68 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 2 papers)
44% identity, 83% coverage: 14:249/283 of query aligns to 11:259/305 of Q96Y68
- C12 (= C15) binding
- C15 (= C18) binding
- C46 (≠ Q49) binding
- K49 (= K52) mutation to I: Loss of oxidoreductase activity toward 2-oxoglutarate but retains its activity toward pyruvate.
- D90 (= D91) binding
- GD 91:92 (≠ GC 92:93) binding
- N118 (= N119) binding
- V120 (≠ I121) binding
- GL 122:123 (= GL 123:124) binding
- K125 (= K126) Plays an important role in the binding of CoA; mutation to A: Shows a strong decrease of affinity for CoA and a poor inactivation by 4-fluoro-7-nitrobenzofurazan (NBD-F).
- K173 (≠ P174) mutation to A: Same oxidoreductase activity as the wild-type.
- C197 (= C198) binding
6n2oD 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
35% identity, 95% coverage: 12:280/283 of query aligns to 22:290/291 of 6n2oD
- binding magnesium ion: D101 (= D91), N129 (= N119), I131 (= I121)
- binding succinyl-coenzyme a: I57 (= I47), R62 (≠ K52), L134 (= L124), K136 (= K126)
- binding iron/sulfur cluster: W24 (= W14), C25 (= C15), C28 (= C18), C59 (≠ Q49), C208 (= C198), T210 (≠ S200), F211 (= F201)
- binding thiamine diphosphate: I57 (= I47), G58 (= G48), C59 (≠ Q49), S60 (≠ A50), H76 (= H66), G102 (= G92), D103 (≠ C93), N129 (= N119), I131 (= I121), G133 (= G123), L134 (= L124), T135 (= T125)
6n2oB 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
35% identity, 95% coverage: 12:280/283 of query aligns to 22:290/291 of 6n2oB
- binding 2-oxoglutaric acid: R62 (≠ K52), L134 (= L124)
- binding coenzyme a: K136 (= K126), Y150 (≠ K140)
- binding magnesium ion: D101 (= D91), N129 (= N119), I131 (= I121)
- binding iron/sulfur cluster: W24 (= W14), C25 (= C15), C28 (= C18), C59 (≠ Q49), C208 (= C198), T210 (≠ S200), F211 (= F201)
- binding thiamine diphosphate: I57 (= I47), G58 (= G48), C59 (≠ Q49), S60 (≠ A50), H76 (= H66), G102 (= G92), D103 (≠ C93), N129 (= N119), I131 (= I121), Y132 (= Y122), G133 (= G123), L134 (= L124), T135 (= T125)
6n2nB Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
35% identity, 95% coverage: 12:280/283 of query aligns to 22:290/291 of 6n2nB
- binding magnesium ion: D101 (= D91), N129 (= N119), I131 (= I121)
- binding iron/sulfur cluster: W24 (= W14), C25 (= C15), C28 (= C18), H30 (≠ N20), C59 (≠ Q49), C208 (= C198), T210 (≠ S200), F211 (= F201)
- binding thiamine diphosphate: I57 (= I47), G58 (= G48), C59 (≠ Q49), S60 (≠ A50), H76 (= H66), G100 (= G90), D101 (= D91), G102 (= G92), D103 (≠ C93), N129 (= N119), I131 (= I121), Y132 (= Y122), G133 (= G123), L134 (= L124), T135 (= T125)
5b48B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
40% identity, 92% coverage: 14:274/283 of query aligns to 7:271/286 of 5b48B
- binding magnesium ion: D84 (= D91), N112 (= N119), V114 (≠ I121)
- binding iron/sulfur cluster: C8 (= C15), C11 (= C18), C42 (≠ Q49), C183 (= C198), T185 (≠ S200)
- binding 2-[(2E)-3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-(1-oxidanylpropylidene)-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: I40 (= I47), G41 (= G48), C42 (≠ Q49), S43 (≠ A50), H59 (= H66), G85 (= G92), D86 (≠ C93), N112 (= N119), V114 (≠ I121), Y115 (= Y122), G116 (= G123), L117 (= L124)
5b47B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
37% identity, 93% coverage: 14:275/283 of query aligns to 4:261/275 of 5b47B
- binding magnesium ion: D83 (= D91), N111 (= N119)
- binding iron/sulfur cluster: C5 (= C15), C8 (= C18), C39 (≠ Q49), C179 (= C198)
- binding thiamine diphosphate: I37 (= I47), G38 (= G48), C39 (≠ Q49), S40 (≠ A50), H58 (= H66), G84 (= G92), D85 (≠ C93), N111 (= N119), V113 (≠ I121), Y114 (= Y122), L116 (= L124)
5exdF Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
28% identity, 40% coverage: 85:198/283 of query aligns to 104:225/310 of 5exdF
- active site: N143 (≠ L124)
- binding magnesium ion: D110 (= D91), N138 (= N119), S140 (≠ I121)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-[1,1,2-tris(oxidanyl)-2-oxidanylidene-ethyl]-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: D110 (= D91), G111 (= G92), Y136 (≠ H117), N138 (= N119), S140 (≠ I121), Y141 (= Y122), A142 (≠ G123), N143 (≠ L124), T144 (= T125)
- binding iron/sulfur cluster: A142 (≠ G123), C225 (= C198)
Sites not aligning to the query:
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-[1,1,2-tris(oxidanyl)-2-oxidanylidene-ethyl]-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: 50, 51, 52, 74
- binding iron/sulfur cluster: 24, 27, 29, 52, 227
5c4iC Structure of an oxalate oxidoreductase (see paper)
28% identity, 40% coverage: 85:198/283 of query aligns to 104:225/312 of 5c4iC
- active site: N143 (≠ L124)
- binding magnesium ion: D110 (= D91), N138 (= N119), S140 (≠ I121)
- binding iron/sulfur cluster: A142 (≠ G123), C225 (= C198)
- binding thiamine diphosphate: G109 (= G90), D110 (= D91), G111 (= G92), Y136 (≠ H117), N138 (= N119), S140 (≠ I121), Y141 (= Y122), A142 (≠ G123), N143 (≠ L124), T144 (= T125)
Sites not aligning to the query:
5exeC Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
28% identity, 40% coverage: 85:198/283 of query aligns to 104:225/314 of 5exeC
- active site: N143 (≠ L124)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-carboxy-4-methyl-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: G109 (= G90), D110 (= D91), G111 (= G92), Y136 (≠ H117), N138 (= N119), S140 (≠ I121), Y141 (= Y122), A142 (≠ G123), N143 (≠ L124), T144 (= T125)
- binding magnesium ion: D110 (= D91), D130 (= D111), N138 (= N119), S140 (≠ I121), L211 (≠ I184), Q213 (≠ H186)
- binding iron/sulfur cluster: C225 (= C198)
Sites not aligning to the query:
Query Sequence
>8499412 FitnessBrowser__Miya:8499412
MDIEVYGEYKKTAWCPGCGNHDVMKAVRQALAGLDLAPNRVAHVSGIGQAAKAPHYIDLN
GFNGLHGRGLPPAQAIKLCNPELTVIAQSGDGCNYGEGGNHFLAAIRRNVDMTLLVHDNQ
IYGLTKGQASPTTPEGQITKSQPDGVRNAPFNPIAVAVAMKCSFVARSFSGNTPHLVKMI
QLAIQHKGFALVDLFSPCVSFNKVNTFGWYKQRCQELPEDYDPTDWAAAMQVAQEFGERI
PIGVIYRNDRPSLDASLPVLQKGPLGRQPVDRDGLRALMQSYT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory