SitesBLAST
Comparing 8499437 FitnessBrowser__Miya:8499437 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 89% coverage: 34:318/322 of query aligns to 35:323/334 of 5aovA
- active site: L100 (≠ G98), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H285)
- binding glyoxylic acid: M52 (≠ N51), L53 (≠ K52), L53 (≠ K52), Y74 (≠ L72), A75 (= A73), V76 (≠ T74), G77 (= G75), R241 (= R237), H288 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T74), T104 (≠ V102), F158 (= F155), G159 (= G156), R160 (≠ N157), I161 (≠ M158), S180 (= S177), R181 (≠ P178), A211 (≠ H207), V212 (≠ C208), P213 (= P209), T218 (= T214), I239 (≠ T235), A240 (= A236), R241 (= R237), H288 (= H285), G290 (≠ A287)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
33% identity, 80% coverage: 54:311/322 of query aligns to 53:320/334 of 3kb6B
- active site: S97 (≠ G98), R231 (= R237), D255 (= D261), E260 (= E266), H294 (= H285)
- binding lactic acid: S72 (≠ A73), V73 (≠ T74), G74 (= G75), Y96 (= Y97), R231 (= R237), H294 (= H285)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ T74), Y96 (= Y97), V101 (= V102), G150 (= G156), R151 (≠ N157), I152 (≠ M158), D171 (≠ S177), V172 (≠ P178), P203 (= P209), T229 (= T235), A230 (= A236), R231 (= R237), H294 (= H285), A296 (= A287), Y297 (≠ W288)
Sites not aligning to the query:
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
38% identity, 78% coverage: 69:319/322 of query aligns to 79:336/336 of 5z20F
- active site: S108 (≠ G98), R241 (= R237), D265 (= D261), E270 (= E266), H302 (= H285)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y97), G160 (= G156), Q161 (≠ N157), I162 (≠ M158), Y180 (= Y176), D181 (≠ S177), P182 (= P178), C212 (= C208), P213 (= P209), T218 (= T214), T239 (= T235), G240 (≠ A236), R241 (= R237), H302 (= H285), A304 (= A287)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
35% identity, 82% coverage: 47:311/322 of query aligns to 45:304/304 of 1wwkA
- active site: S96 (≠ G98), R230 (= R237), D254 (= D261), E259 (= E266), H278 (= H285)
- binding nicotinamide-adenine-dinucleotide: V100 (= V102), G146 (= G154), F147 (= F155), G148 (= G156), R149 (≠ N157), I150 (≠ M158), Y168 (= Y176), D169 (≠ S177), P170 (= P178), V201 (≠ C208), P202 (= P209), T207 (= T214), T228 (= T235), S229 (≠ A236), D254 (= D261), H278 (= H285), G280 (≠ A287)
6p2iA Acyclic imino acid reductase (bsp5) in complex with NADPH and d-arg (see paper)
31% identity, 98% coverage: 1:317/322 of query aligns to 1:306/307 of 6p2iA
- binding d-arginine: E51 (≠ N51), T73 (≠ A73), T74 (= T74), S75 (≠ G75), Y97 (= Y97), W277 (= W288)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S98 (≠ G98), V102 (= V102), G149 (= G154), I150 (≠ F155), G151 (= G156), Q152 (≠ N157), I153 (≠ M158), N172 (≠ S177), K173 (≠ P178), S174 (≠ N179), R176 (= R181), H199 (= H207), I200 (≠ C208), P201 (= P209), T206 (= T214), T227 (= T235), C228 (≠ A236), W277 (= W288)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
34% identity, 82% coverage: 56:319/322 of query aligns to 67:346/346 of 4zgsA
- active site: S111 (≠ G98), R244 (= R237), D268 (= D261), E273 (= E266), H311 (= H285)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y97), G163 (= G156), A164 (≠ N157), I165 (≠ M158), D184 (≠ N179), C215 (= C208), P216 (= P209), L218 (≠ T211), S220 (≠ A213), T221 (= T214), S243 (≠ A236), H311 (= H285), F314 (≠ W288)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
38% identity, 82% coverage: 47:311/322 of query aligns to 45:303/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
38% identity, 82% coverage: 47:311/322 of query aligns to 46:304/525 of 3ddnB
5z21B The ternary structure of d-lactate dehydrogenase from fusobacterium nucleatum with nadh and oxamate (see paper)
34% identity, 82% coverage: 51:313/322 of query aligns to 58:324/331 of 5z21B
- active site: S101 (≠ G98), R235 (= R237), D259 (= D261), E264 (vs. gap), H296 (= H285)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y97), I105 (≠ V102), G153 (= G156), K154 (≠ N157), I155 (≠ M158), D174 (≠ S177), L175 (vs. gap), P207 (= P209), T212 (= T214), T233 (= T235), G234 (≠ A236), R235 (= R237), H296 (= H285), Y299 (≠ W288)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
34% identity, 86% coverage: 34:311/322 of query aligns to 34:313/332 of 6biiA
- active site: L99 (≠ G98), R240 (= R237), D264 (= D261), E269 (= E266), H287 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ T74), T103 (≠ V102), G156 (= G154), F157 (= F155), G158 (= G156), R159 (≠ N157), I160 (≠ M158), A179 (≠ P178), R180 (≠ N179), S181 (≠ T180), K183 (≠ T182), V211 (≠ C208), P212 (= P209), E216 (≠ A213), T217 (= T214), V238 (≠ T235), A239 (= A236), R240 (= R237), D264 (= D261), H287 (= H285), G289 (≠ A287)
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
34% identity, 91% coverage: 31:322/322 of query aligns to 40:326/406 of 2p9eA
- active site: N104 (≠ G98), R236 (= R237), D260 (= D261), E265 (= E266), H288 (= H285)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G156), H157 (≠ N157), I158 (≠ M158), Y176 (= Y176), D177 (≠ S177), I178 (≠ P178), H206 (= H207), V207 (≠ C208), P208 (= P209), S212 (≠ A213), A234 (≠ T235), S235 (≠ A236), R236 (= R237), H288 (= H285), G290 (≠ A287)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
33% identity, 80% coverage: 56:313/322 of query aligns to 58:307/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
33% identity, 80% coverage: 56:313/322 of query aligns to 56:305/311 of 3bazA
- active site: L98 (≠ G98), R230 (= R237), A251 (≠ L258), D254 (= D261), E259 (= E266), H277 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ T74), G149 (= G154), L150 (≠ F155), G151 (= G156), R152 (≠ N157), I153 (≠ M158), S172 (= S177), R173 (≠ P178), S174 (≠ N179), C201 (= C208), P202 (= P209), T207 (= T214), I228 (≠ T235), G229 (≠ A236), R230 (= R237), D254 (= D261), H277 (= H285), G279 (≠ A287)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 91% coverage: 31:322/322 of query aligns to 44:330/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
34% identity, 91% coverage: 31:322/322 of query aligns to 38:324/404 of 1psdA
- active site: N102 (≠ G98), R234 (= R237), D258 (= D261), E263 (= E266), H286 (= H285)
- binding nicotinamide-adenine-dinucleotide: N102 (≠ G98), H155 (≠ N157), I156 (≠ M158), D175 (≠ S177), I176 (≠ P178), K179 (≠ R181), H204 (= H207), V205 (≠ C208), P206 (= P209), A232 (≠ T235), S233 (≠ A236), R234 (= R237), H286 (= H285)
Sites not aligning to the query:
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
34% identity, 91% coverage: 31:322/322 of query aligns to 40:326/406 of 1ybaA
- active site: N104 (≠ G98), R236 (= R237), D260 (= D261), E265 (= E266), H288 (= H285)
- binding 2-oxoglutaric acid: R56 (≠ T50), S57 (≠ N51), C79 (≠ A73), I80 (≠ T74)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ T74), F102 (≠ G96), V108 (= V102), G154 (= G154), G156 (= G156), H157 (≠ N157), I158 (≠ M158), Y176 (= Y176), D177 (≠ S177), I178 (≠ P178), K181 (≠ R181), H206 (= H207), V207 (≠ C208), P208 (= P209), A234 (≠ T235), S235 (≠ A236), R236 (= R237), H288 (= H285), G290 (≠ A287)
- binding phosphate ion: G81 (= G75), N83 (≠ D77)
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
33% identity, 76% coverage: 68:311/322 of query aligns to 71:321/330 of 4cukA
- active site: S101 (≠ G98), R234 (= R237), D258 (= D261), E263 (vs. gap), H295 (= H285)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y97), G153 (= G156), K154 (≠ N157), I155 (≠ M158), F173 (≠ Y176), D174 (≠ S177), P175 (= P178), H204 (= H207), C205 (= C208), P206 (= P209), N211 (≠ T214), T232 (= T235), Y260 (≠ V263), H295 (= H285), A297 (= A287)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
32% identity, 87% coverage: 34:313/322 of query aligns to 37:317/324 of 2gcgA
- active site: L103 (≠ G98), R241 (= R237), D265 (= D261), E270 (= E266), H289 (= H285)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (vs. gap), S78 (≠ A73), V79 (≠ T74), G80 (= G75), R241 (= R237), H289 (= H285)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ T74), T107 (≠ V102), G156 (= G154), G158 (= G156), I160 (≠ M158), G180 (vs. gap), R181 (vs. gap), R184 (≠ N179), C212 (= C208), S213 (≠ P209), T218 (= T214), I239 (≠ T235), R241 (= R237), D265 (= D261), H289 (= H285), G291 (≠ A287)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
32% identity, 87% coverage: 34:313/322 of query aligns to 41:321/328 of Q9UBQ7
8atiA Human ctbp2(31-364) in complex with rai2 peptide(315-322)
33% identity, 88% coverage: 29:311/322 of query aligns to 36:315/330 of 8atiA
- binding nicotinamide-adenine-dinucleotide: S74 (≠ T74), T102 (≠ V102), G155 (= G154), G157 (= G156), R158 (≠ N157), T159 (≠ M158), D178 (≠ S177), P179 (= P178), Y180 (≠ N179), H210 (= H207), C211 (= C208), N212 (≠ P209), A238 (≠ T235), R240 (= R237), H289 (= H285), A291 (= A287), W292 (= W288)
- binding : H37 (= H30)
Sites not aligning to the query:
Query Sequence
>8499437 FitnessBrowser__Miya:8499437
MRIVVLDGYTLNPGDNPWDAVAALGELTVHDRTPREAIRERAAGAHMVLTNKTPLDADTI
AALPDLAYIGVLATGYDVVDIRAAAARSIPVCNVPGYGTEAVAQHVFAFLLELCRRIARH
DASVKVGNWSANKDWCFWETTQIELTGKAMGIVGFGNMGKRVGQIANAFGMKVLAYSPNT
RTMPGYEPFAYVSLDELFARSDVVTLHCPLTDATRGMVNRVRLASMKQGAILINTARGPL
LDEAAVAAALNDNHLGGLGVDVVAVEPIRPDNPLLTAKNCLITPHLAWATLTARQTLMRV
TAGNIRAFLAGAPTNVVKAPTV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory