SitesBLAST
Comparing 8499492 FitnessBrowser__Miya:8499492 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
37% identity, 39% coverage: 81:138/147 of query aligns to 142:208/348 of 5t61L
- binding iron/sulfur cluster: I146 (= I85), C153 (= C92), C156 (= C95), C159 (= C98), C163 (= C102), P164 (= P103), I168 (≠ L107), I186 (≠ V116), C193 (= C123), H195 (≠ A125), C196 (= C126), G197 (= G127), C199 (= C129), C203 (= C133), P204 (= P134), I208 (≠ M138)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 129, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
6u8yN Structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex (see paper)
32% identity, 50% coverage: 67:140/147 of query aligns to 21:103/176 of 6u8yN
- binding iron/sulfur cluster: H49 (vs. gap), C56 (= C92), I57 (≠ M93), G58 (≠ H94), C59 (= C95), M61 (= M97), C62 (= C98), C66 (= C102), P67 (= P103), I71 (≠ L107), M73 (= M109), C86 (= C123), T87 (= T124), C89 (= C126), Q90 (≠ G127), F91 (≠ L128), C92 (= C129), C96 (= C133), L101 (≠ M138)
7b0nI 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
37% identity, 42% coverage: 83:144/147 of query aligns to 83:151/191 of 7b0nI
- binding iron/sulfur cluster: C92 (= C92), I93 (≠ M93), A94 (≠ H94), C95 (= C95), K96 (≠ G96), C98 (= C98), C102 (= C102), C131 (= C123), I132 (≠ T124), Y133 (≠ A125), C134 (= C126), G135 (= G127), C137 (= C129), C141 (= C133), E148 (= E141)
Sites not aligning to the query:
7bkcK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (dimeric, composite structure) (see paper)
30% identity, 44% coverage: 78:142/147 of query aligns to 63:143/321 of 7bkcK
- binding iron/sulfur cluster: C77 (= C92), S78 (≠ M93), Y79 (≠ H94), C80 (= C95), G81 (= G96), C83 (= C98), C87 (= C102), L92 (= L107), I119 (≠ F118), C124 (= C123), V125 (≠ T124), C127 (= C126), C130 (= C129), C134 (= C133), P135 (= P134), I139 (≠ M138)
Sites not aligning to the query:
- binding iron/sulfur cluster: 36, 37, 39, 42, 46, 47, 51, 178, 183, 184, 185, 186, 187, 189, 193, 194, 198, 208, 215, 216, 219, 221, 222, 226, 257, 258, 259, 260, 261, 263, 267, 268
7bkbK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
30% identity, 44% coverage: 78:142/147 of query aligns to 63:143/386 of 7bkbK
- binding iron/sulfur cluster: C77 (= C92), S78 (≠ M93), Y79 (≠ H94), C80 (= C95), G81 (= G96), C83 (= C98), C87 (= C102), L92 (= L107), I119 (≠ F118), C124 (= C123), V125 (≠ T124), C127 (= C126), C130 (= C129), C134 (= C133), I139 (≠ M138)
Sites not aligning to the query:
- binding iron/sulfur cluster: 36, 37, 39, 42, 46, 47, 51, 173, 174, 175, 176, 179, 183, 186, 211, 212, 214, 215, 217, 221, 222, 241, 248, 249, 251, 254, 258, 259, 263, 265, 273, 280, 281, 284, 286, 287, 291, 322, 323, 324, 325, 326, 328, 332, 333
7ak5I Cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a (see paper)
34% identity, 38% coverage: 83:138/147 of query aligns to 70:133/178 of 7ak5I
- binding iron/sulfur cluster: C79 (= C92), I80 (≠ M93), A81 (≠ H94), C82 (= C95), K83 (≠ G96), C85 (= C98), C89 (= C102), C118 (= C123), I119 (≠ T124), Y120 (≠ A125), C121 (= C126), G122 (= G127), C124 (= C129), C128 (= C133), I133 (≠ M138)
Sites not aligning to the query:
8e73S8 qcr9 (see paper)
34% identity, 38% coverage: 83:138/147 of query aligns to 73:136/181 of 8e73S8
- binding iron/sulfur cluster: C82 (= C92), I83 (≠ M93), C85 (= C95), K86 (≠ G96), C88 (= C98), C92 (= C102), I97 (≠ L107), C121 (= C123), I122 (≠ T124), Y123 (≠ A125), C124 (= C126), G125 (= G127), F126 (≠ L128), C127 (= C129), C131 (= C133), P132 (= P134), A135 (= A137), I136 (≠ M138)
Sites not aligning to the query:
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
37% identity, 39% coverage: 89:146/147 of query aligns to 6:65/102 of 8a8oD
- binding iron/sulfur cluster: C9 (= C92), I10 (≠ M93), G11 (≠ H94), C12 (= C95), G13 (= G96), C15 (= C98), C19 (= C102), P20 (= P103), S32 (≠ V115), C40 (= C123), W41 (≠ T124), D42 (≠ A125), C43 (= C126), A44 (≠ G127), C46 (= C129), C50 (= C133), I55 (vs. gap)
Sites not aligning to the query:
7arcI Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
34% identity, 38% coverage: 83:138/147 of query aligns to 91:154/199 of 7arcI
- binding iron/sulfur cluster: C100 (= C92), I101 (≠ M93), S102 (≠ H94), C103 (= C95), K104 (≠ G96), C106 (= C98), C110 (= C102), P111 (= P103), I115 (≠ L107), Y132 (≠ F118), C139 (= C123), I140 (≠ T124), Y141 (≠ A125), C142 (= C126), G143 (= G127), F144 (≠ L128), C145 (= C129), C149 (= C133), A153 (= A137), I154 (≠ M138)
- binding : R131 (≠ V117)
Sites not aligning to the query:
1durA Replacement for 1fdx 2(4fe4s) ferredoxin from (now) peptostreptococcus asaccharolyticus
44% identity, 35% coverage: 90:141/147 of query aligns to 6:54/55 of 1durA
- binding iron/sulfur cluster: C8 (= C92), I9 (≠ M93), A10 (≠ H94), C11 (= C95), G12 (= G96), C14 (= C98), C18 (= C102), C22 (≠ A106), I23 (≠ L107), Y29 (≠ V116), I31 (≠ F118), C36 (= C123), I37 (≠ T124), C39 (= C126), G40 (= G127), C42 (= C129), C46 (= C133), P47 (= P134)
Sites not aligning to the query:
8b9zI Drosophila melanogaster complex i in the active state (dm1) (see paper)
34% identity, 38% coverage: 83:138/147 of query aligns to 78:141/186 of 8b9zI
- binding iron/sulfur cluster: C87 (= C92), I88 (≠ M93), A89 (≠ H94), C90 (= C95), K91 (≠ G96), C93 (= C98), C97 (= C102), P98 (= P103), Y119 (≠ F118), C126 (= C123), I127 (≠ T124), Y128 (≠ A125), C129 (= C126), G130 (= G127), F131 (≠ L128), C132 (= C129), C136 (= C133), A140 (= A137), I141 (≠ M138)
Sites not aligning to the query:
Q9VF27 NADH dehydrogenase (ubiquinone) 23 kDa subunit; EC 7.1.1.2 from Drosophila melanogaster (Fruit fly) (see paper)
34% identity, 38% coverage: 83:138/147 of query aligns to 109:172/217 of Q9VF27
Sites not aligning to the query:
- 199 G→D: Disrupts mitochondrial function and results in enlarged mitochondria. Neurons present vacuolar lesions leading to neurodegeneration in the central brain. Results in behavioral defects and shorten lifespan.
5exdH Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
41% identity, 38% coverage: 83:138/147 of query aligns to 228:281/291 of 5exdH
- binding iron/sulfur cluster: P230 (≠ I85), C237 (= C92), T238 (≠ M93), E239 (≠ H94), C240 (= C95), Y241 (≠ G96), C243 (= C98), C247 (= C102), P259 (≠ R114), C266 (= C123), K267 (≠ T124), G268 (≠ A125), C269 (= C126), G270 (= G127), C272 (= C129), C276 (= C133), S278 (≠ V135), L281 (≠ M138)
7zm7I Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
34% identity, 43% coverage: 83:145/147 of query aligns to 77:146/185 of 7zm7I
- binding iron/sulfur cluster: C86 (= C92), I87 (≠ M93), A88 (≠ H94), C89 (= C95), K90 (≠ G96), C92 (= C98), C96 (= C102), P97 (= P103), I101 (≠ L107), Y118 (≠ F118), C125 (= C123), I126 (≠ T124), Y127 (≠ A125), C128 (= C126), C131 (= C129), C135 (= C133), A139 (= A137), I140 (≠ M138)
Sites not aligning to the query:
5c4iE Structure of an oxalate oxidoreductase (see paper)
41% identity, 38% coverage: 83:138/147 of query aligns to 249:302/312 of 5c4iE
- binding iron/sulfur cluster: C258 (= C92), T259 (≠ M93), E260 (≠ H94), C261 (= C95), Y262 (≠ G96), C264 (= C98), C268 (= C102), C272 (≠ A106), C287 (= C123), K288 (≠ T124), G289 (≠ A125), C290 (= C126), G291 (= G127), C293 (= C129), C297 (= C133), P298 (= P134), S299 (≠ V135), L302 (≠ M138)
1clfA Clostridium pasteurianum ferredoxin (see paper)
46% identity, 33% coverage: 90:137/147 of query aligns to 6:51/55 of 1clfA
- binding iron/sulfur cluster: C8 (= C92), V9 (≠ M93), C11 (= C95), G12 (= G96), A13 (≠ M97), C14 (= C98), C18 (= C102), P19 (= P103), V20 (≠ T104), F30 (≠ V116), C37 (= C123), I38 (≠ T124), C40 (= C126), N42 (≠ L128), C43 (= C129), C47 (= C133), A51 (= A137)
Sites not aligning to the query:
P00195 Ferredoxin from Clostridium pasteurianum (see 2 papers)
46% identity, 33% coverage: 90:137/147 of query aligns to 7:52/56 of P00195
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5gupH structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
33% identity, 38% coverage: 83:138/147 of query aligns to 68:131/176 of 5gupH
- binding iron/sulfur cluster: C77 (= C92), I78 (≠ M93), A79 (≠ H94), C80 (= C95), K81 (≠ G96), C83 (= C98), C87 (= C102), C116 (= C123), I117 (≠ T124), Y118 (≠ A125), C119 (= C126), G120 (= G127), F121 (≠ L128), C122 (= C129), C126 (= C133), P127 (= P134), A130 (= A137), I131 (≠ M138)
- binding : R108 (≠ V117)
Sites not aligning to the query:
8b6fAL ndutt15 (see paper)
33% identity, 38% coverage: 83:138/147 of query aligns to 109:172/218 of 8b6fAL
- binding iron/sulfur cluster: C118 (= C92), I119 (≠ M93), C121 (= C95), K122 (≠ G96), C124 (= C98), C128 (= C102), I133 (≠ L107), Y150 (≠ F118), C157 (= C123), I158 (≠ T124), Y159 (≠ A125), C160 (= C126), G161 (= G127), C163 (= C129), C167 (= C133), P168 (= P134), A171 (= A137), I172 (≠ M138)
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
35% identity, 35% coverage: 88:138/147 of query aligns to 578:627/630 of 8a6tB
- binding iron/sulfur cluster: C582 (= C92), I583 (≠ M93), C585 (= C95), C588 (= C98), C592 (= C102), A596 (= A106), I597 (≠ L107), I607 (≠ F118), C612 (= C123), C618 (= C129), C622 (= C133), K624 (≠ V135), A626 (= A137), I627 (≠ M138)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding flavin mononucleotide: 201, 227, 230, 355, 535, 536
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 320, 337, 340, 341, 342, 433
- binding iron/sulfur cluster: 487, 488, 489, 491, 494, 534, 536, 537, 575, 577
- binding zinc ion: 471, 558, 564
Query Sequence
>8499492 FitnessBrowser__Miya:8499492
MTEQQTKPYRKNIHLTFPPEISGKPIVSDLVRRYDLTVNILKAQITPRKEGYLTLEISGG
EDNCLKGIAYLREQDVTVTDVSQRISRDEDSCMHCGMCTAICPTSALAMDIEARVVVFDK
DRCTACGLCTRVCPVGAMNVEVENGGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory