Comparing 8499572 FitnessBrowser__Miya:8499572 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
40% identity, 98% coverage: 6:358/362 of query aligns to 3:361/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
40% identity, 98% coverage: 6:358/362 of query aligns to 3:361/362 of 1wopA
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
40% identity, 98% coverage: 6:358/362 of query aligns to 3:361/362 of 1wooA
Sites not aligning to the query:
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
36% identity, 94% coverage: 6:346/362 of query aligns to 3:352/363 of 3a8iA
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
35% identity, 96% coverage: 4:351/362 of query aligns to 33:394/403 of P48728
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
35% identity, 96% coverage: 4:351/362 of query aligns to 2:363/371 of 1wsvA
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
29% identity, 88% coverage: 3:319/362 of query aligns to 429:784/830 of Q9AGP8
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
29% identity, 88% coverage: 3:319/362 of query aligns to 426:781/827 of 1pj7A
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
29% identity, 88% coverage: 3:319/362 of query aligns to 427:782/828 of 1pj6A
Sites not aligning to the query:
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
29% identity, 88% coverage: 3:319/362 of query aligns to 426:781/827 of 3gsiA
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
28% identity, 88% coverage: 7:323/362 of query aligns to 579:928/967 of Q46337
Sites not aligning to the query:
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
27% identity, 88% coverage: 7:323/362 of query aligns to 577:926/965 of 2gagA
Sites not aligning to the query:
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
28% identity, 76% coverage: 7:280/362 of query aligns to 577:875/965 of Q50LF0
Sites not aligning to the query:
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
28% identity, 76% coverage: 7:280/362 of query aligns to 576:874/963 of 3ad7A
Sites not aligning to the query:
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
28% identity, 76% coverage: 7:280/362 of query aligns to 576:874/963 of 1vrqA
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
23% identity, 87% coverage: 37:351/362 of query aligns to 51:368/369 of 3tfjA
Sites not aligning to the query:
3tfiA Dmsp-dependent demethylase from p. Ubique - with substrate dmsp (see paper)
23% identity, 87% coverage: 37:351/362 of query aligns to 51:368/369 of 3tfiA
Sites not aligning to the query:
Q4FP21 Dimethylsulfonioproprionate demethylase DmdA; EC 2.1.1.269 from Pelagibacter ubique (strain HTCC1062) (see paper)
23% identity, 87% coverage: 37:351/362 of query aligns to 51:368/369 of Q4FP21
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 89% coverage: 20:342/362 of query aligns to 484:833/866 of Q9UI17
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 90% coverage: 38:361/362 of query aligns to 476:813/824 of 4pabB
Sites not aligning to the query:
>8499572 FitnessBrowser__Miya:8499572
MSDLLQTPLSAWHRAAGAKMAPFAGWDMPIQYPTGIIAEHVQTRESAALFDICHMGEFTL
RGPGARDALSRAVSHNLETLKPGRCRYGFLLNEAGGILDDLIVYCVAEDDYMLVVNGACT
ESDFAALRSRLPAVLPFEDISARTAKLDLQGPKSFDVLEAVLGESFRDLPYFGFRSVVFG
GAPLLVSRTGYTGELGVELYLPWDKAEALWTALLADERVKPAGLGARDTLRLEVGLPLYG
HDLDDTHTPAEAGYGGMLTNPADYVGKGADREVREPLVALSIPGRRSARHGDVVALPDGT
VAGVVTSGSFCPSLGYAVALARVAAAHAEAPTFVVKAAKVELEATRVALPFYTQGTARTK
LI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory