Comparing 8499579 FitnessBrowser__Miya:8499579 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
46% identity, 100% coverage: 2:251/251 of query aligns to 3:248/250 of 4y96A
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
43% identity, 97% coverage: 2:245/251 of query aligns to 403:642/654 of P36204
Sites not aligning to the query:
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
43% identity, 100% coverage: 2:251/251 of query aligns to 5:250/252 of 6neeB
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
42% identity, 96% coverage: 2:243/251 of query aligns to 2:239/248 of 5zfxB
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
41% identity, 100% coverage: 2:251/251 of query aligns to 9:253/255 of 6ooiC
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
42% identity, 100% coverage: 2:251/251 of query aligns to 6:250/252 of 6oogA
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
41% identity, 100% coverage: 2:251/251 of query aligns to 3:249/253 of P00943
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
41% identity, 100% coverage: 2:251/251 of query aligns to 2:248/251 of 1btmA
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
40% identity, 99% coverage: 2:249/251 of query aligns to 3:247/253 of P27876
P00939 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
42% identity, 100% coverage: 2:251/251 of query aligns to 6:247/249 of P00939
4owgA Crystal structure of rabbit muscle triosephosphate isomerase-pep complex
42% identity, 100% coverage: 2:251/251 of query aligns to 3:244/246 of 4owgA
1r2rB Crystal structure of rabbit muscle triosephosphate isomerase (see paper)
42% identity, 100% coverage: 2:251/251 of query aligns to 4:245/247 of 1r2rB
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
40% identity, 98% coverage: 4:249/251 of query aligns to 6:250/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
40% identity, 98% coverage: 4:249/251 of query aligns to 6:250/254 of 3uwwA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
40% identity, 98% coverage: 4:249/251 of query aligns to 5:249/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
40% identity, 98% coverage: 4:249/251 of query aligns to 5:249/253 of Q6GIL6
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
40% identity, 98% coverage: 4:249/251 of query aligns to 7:251/255 of 3uwvA
P60174 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Homo sapiens (Human) (see 7 papers)
42% identity, 100% coverage: 2:251/251 of query aligns to 6:247/249 of P60174
4pocB Structure of triosephosphate isomerase wild type human enzyme. (see paper)
42% identity, 100% coverage: 2:251/251 of query aligns to 4:245/247 of 4pocB
1htiB Crystal structure of recombinant human triosephosphate isomerase at 2.8 angstroms resolution. Triosephosphate isomerase related human genetic disorders and comparison with the trypanosomal enzyme (see paper)
42% identity, 100% coverage: 2:251/251 of query aligns to 5:246/248 of 1htiB
>8499579 FitnessBrowser__Miya:8499579
MKKLMAANWKMYKTAGEARTTAASLAALTADTLPDDREVVIFPQFTALSPVADALRHATG
YSVGGQDVYPAAEGAYTGEISPGMLMDCGCAWVLTGHSERRHVIGESDELVGAKTAFSIN
AGLKVVLCIGETIEEREAGRLGEVLERQLETGLAGVKGDAVPAAIAVAYEPVWAIGTGKV
AGPPEIVEAHALVRQLLVARFGEGGVAVRILYGGSVKPENAREIIALDNVDGVLVGGASL
QADSFSRIILA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory