SitesBLAST
Comparing 8499632 FitnessBrowser__Miya:8499632 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3asvA The closed form of serine dehydrogenase complexed with NADP+ (see paper)
57% identity, 92% coverage: 21:266/267 of query aligns to 2:247/248 of 3asvA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G26), T9 (= T28), G11 (= G30), F12 (= F31), R32 (= R51), R33 (= R52), D54 (= D74), V55 (= V75), N81 (= N101), G83 (= G103), I132 (≠ L152), S134 (= S154), Y147 (= Y167), K151 (= K171), G178 (= G198), V180 (≠ A200), T183 (≠ S202), E184 (= E203), F185 (= F204)
- binding phosphate ion: S134 (= S154), Y147 (= Y167), G178 (= G198), F185 (= F204)
6ixjA The crystal structure of sulfoacetaldehyde reductase from klebsiella oxytoca (see paper)
47% identity, 92% coverage: 21:266/267 of query aligns to 3:250/251 of 6ixjA
- binding 2-hydroxyethylsulfonic acid: S138 (= S154), Y145 (= Y161), Y151 (= Y167)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G26), T10 (= T28), S11 (≠ A29), G12 (= G30), F13 (= F31), R33 (= R51), R34 (= R52), D57 (= D74), V58 (= V75), N84 (= N101), A85 (= A102), G86 (= G103), T108 (= T125), I136 (≠ L152), S138 (= S154), Y151 (= Y167), K155 (= K171), P181 (= P197), G182 (= G198), A184 (= A200), T186 (≠ S202), E187 (= E203), F188 (= F204)
Q9P7B4 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.381 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 93% coverage: 19:266/267 of query aligns to 6:256/259 of Q9P7B4
- S42 (≠ D54) modified: Phosphoserine
- T43 (≠ R55) modified: Phosphothreonine
Q05016 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.-; EC 1.1.1.381 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
35% identity, 89% coverage: 22:258/267 of query aligns to 16:259/267 of Q05016
- N102 (= N101) binding
- Y168 (= Y167) binding
- K172 (= K171) binding
3rkuA Substrate fingerprint and the structure of NADP+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with NADP+
35% identity, 89% coverage: 22:258/267 of query aligns to 17:260/268 of 3rkuA
- active site: A107 (= A105), N128 (= N126), S156 (= S154), Y169 (= Y167), K173 (= K171), N214 (≠ D212)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G26), S23 (≠ T28), G25 (= G30), I26 (≠ F31), R49 (= R51), R50 (= R52), D76 (= D74), I77 (≠ V75), N103 (= N101), A104 (= A102), G105 (= G103), K106 (≠ L104), S156 (= S154), Y169 (= Y167), K173 (= K171), P199 (= P197), G200 (= G198), V202 (≠ A200), T204 (≠ S202), E205 (= E203), F206 (= F204)
A0A1U8QWA2 Glycine betaine reductase ATRR; Nonribosomal peptide synthetase-like protein ATRR; EC 1.2.1.-; EC 1.1.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
36% identity, 90% coverage: 19:259/267 of query aligns to 1029:1270/1270 of A0A1U8QWA2
- G1036 (= G26) mutation to A: Compromises binding of the cosubstrate NADPH to aldehyde reductase domain R2. Decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
- Y1178 (= Y167) mutation to F: Does not substantially affect carboxylic acid reductase activity but results to a 150-fold loss of aldehyde reductase activity and the accumulation of glycine betaine aldehyde intermediate. Further decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
Sites not aligning to the query:
- 14:418 Adenylation (A) domain
- 643:937 Carboxylic acid reductase domain R1
- 812 Y→F: Abolishes overall carboxylic acid reductase activity but does nor affect aldehyde reductase activity.
- 1026:1256 Aldehyde reductase domain R2
2jahC Biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus (see paper)
39% identity, 91% coverage: 14:257/267 of query aligns to 1:245/246 of 2jahC
- active site: S141 (= S154), Y154 (= Y167), K158 (= K171), A199 (≠ R215)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G26), S15 (≠ T28), S16 (≠ A29), G17 (= G30), I18 (≠ F31), A37 (≠ G50), R38 (= R51), R39 (= R52), D63 (= D74), V64 (= V75), N90 (= N101), A91 (= A102), G92 (= G103), T113 (= T125), M139 (≠ L152), S141 (= S154), Y154 (= Y167), K158 (= K171), P184 (= P197), G185 (= G198), T186 (≠ L199), T187 (≠ A200), T189 (≠ S202), E190 (= E203), L191 (≠ F204)
2ehdB Crystal structure analysis of oxidoreductase
33% identity, 88% coverage: 20:255/267 of query aligns to 5:213/213 of 2ehdB
2japA Clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta- lactamase inhibitor clavulanic acid (see paper)
39% identity, 91% coverage: 15:257/267 of query aligns to 1:244/245 of 2japA
- active site: S140 (= S154), Y153 (= Y167), K157 (= K171), A198 (≠ R215)
- binding (2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylic acid: M93 (≠ A105), S140 (= S154), A142 (≠ T156), Y153 (= Y167), T185 (≠ L199), Y203 (= Y220), R206 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G26), S14 (≠ T28), S15 (≠ A29), G16 (= G30), I17 (≠ F31), A36 (≠ G50), R37 (= R51), R38 (= R52), L61 (≠ F73), D62 (= D74), V63 (= V75), N89 (= N101), A90 (= A102), G91 (= G103), T112 (= T125), M138 (≠ L152), S139 (≠ G153), S140 (= S154), Y153 (= Y167), K157 (= K171), P183 (= P197), T185 (≠ L199), T186 (≠ A200), T188 (≠ S202), E189 (= E203), L190 (≠ F204)
1xg5C Structure of human putative dehydrogenase mgc4172 in complex with nadp
29% identity, 89% coverage: 18:255/267 of query aligns to 9:255/257 of 1xg5C
- active site: S150 (= S154), Y165 (= Y167), K169 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G26), S19 (≠ T28), G21 (= G30), I22 (≠ F31), A41 (≠ G50), R42 (= R51), T43 (≠ R52), D69 (= D74), L70 (≠ V75), N96 (= N101), G98 (= G103), I148 (≠ L152), S150 (= S154), Y165 (= Y167), K169 (= K171), G198 (= G198), V200 (≠ A200), T202 (≠ S202), F204 (= F204), K207 (≠ V207)
3p19A Improved NADPH-dependent blue fluorescent protein (see paper)
32% identity, 89% coverage: 21:258/267 of query aligns to 4:238/239 of 3p19A
- active site: S132 (= S154), Y145 (= Y167), K149 (= K171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G26), S11 (≠ T28), S12 (≠ A29), G13 (= G30), I14 (≠ F31), A33 (≠ G50), R34 (= R51), R35 (= R52), D53 (= D74), V54 (= V75), N80 (= N101), A81 (= A102), G82 (= G103), I130 (≠ L152), S132 (= S154), Y145 (= Y167), K149 (= K171), P175 (= P197), A177 (≠ L199), V178 (≠ A200), T180 (≠ S202), E181 (= E203), L182 (≠ F204)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
29% identity, 86% coverage: 18:246/267 of query aligns to 7:241/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G26), S17 (≠ T28), R18 (≠ A29), I20 (≠ F31), T40 (≠ R51), N62 (≠ D74), V63 (= V75), N89 (= N101), A90 (= A102), I92 (≠ L104), V139 (≠ L152), S141 (= S154), Y154 (= Y167), K158 (= K171), P184 (= P197), G185 (= G198), I187 (≠ A200), T189 (≠ S202), M191 (≠ F204)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
29% identity, 86% coverage: 18:246/267 of query aligns to 7:237/243 of 4i08A
- active site: G19 (= G30), N113 (= N126), S141 (= S154), Q151 (≠ A164), Y154 (= Y167), K158 (= K171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G26), S17 (≠ T28), R18 (≠ A29), I20 (≠ F31), T40 (≠ R51), N62 (≠ D74), V63 (= V75), N89 (= N101), A90 (= A102), G140 (= G153), S141 (= S154), Y154 (= Y167), K158 (= K171), P184 (= P197), G185 (= G198), T189 (≠ S202)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
32% identity, 82% coverage: 23:240/267 of query aligns to 10:221/241 of 5t2uA
- active site: G17 (= G30), T135 (≠ S154), T145 (≠ A164), Y148 (= Y167), K152 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G26), G17 (= G30), R38 (= R51), D39 (≠ R52), R42 (= R55), D60 (= D74), L61 (≠ V75), N83 (= N101), A84 (= A102), Y87 (≠ L108), I133 (≠ L152), T135 (≠ S154), Y148 (= Y167), K152 (= K171), P178 (= P197), P180 (≠ L199), T181 (≠ A200), T183 (≠ S202), T185 (≠ F204), T186 (≠ S205)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
30% identity, 85% coverage: 18:244/267 of query aligns to 3:223/243 of 7emgB
7w61A Crystal structure of farnesol dehydrogenase from helicoverpa armigera (see paper)
29% identity, 90% coverage: 19:257/267 of query aligns to 8:246/249 of 7w61A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G26), S17 (≠ T28), S18 (≠ A29), G19 (= G30), I20 (≠ F31), A39 (≠ G50), R40 (= R51), R41 (= R52), C63 (≠ F73), D64 (= D74), V65 (= V75), N91 (= N101), A92 (= A102), G93 (= G103), I94 (≠ L104), I119 (≠ T125), I147 (≠ L152), Y164 (= Y167), K168 (= K171), P196 (= P197), G197 (= G198), L198 (= L199), V199 (≠ A200), T201 (≠ S202), A202 (≠ E203), M203 (≠ F204)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
29% identity, 82% coverage: 21:240/267 of query aligns to 9:225/244 of 4nbuB
- active site: G18 (= G30), N111 (= N126), S139 (= S154), Q149 (≠ A164), Y152 (= Y167), K156 (= K171)
- binding acetoacetyl-coenzyme a: D93 (≠ G107), K98 (≠ R113), S139 (= S154), N146 (≠ Y161), V147 (≠ P162), Q149 (≠ A164), Y152 (= Y167), F184 (≠ L199), M189 (≠ F204), K200 (≠ G222)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G26), N17 (≠ A29), G18 (= G30), I19 (≠ F31), D38 (= D54), F39 (≠ R55), V59 (≠ F73), D60 (= D74), V61 (= V75), N87 (= N101), A88 (= A102), G89 (= G103), I90 (≠ L104), T137 (≠ L152), S139 (= S154), Y152 (= Y167), K156 (= K171), P182 (= P197), F184 (≠ L199), T185 (≠ A200), T187 (≠ S202), M189 (≠ F204)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
27% identity, 87% coverage: 16:246/267 of query aligns to 2:238/244 of 6wprA
- active site: G16 (= G30), S138 (= S154), Y151 (= Y167)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G26), S14 (≠ T28), R15 (≠ A29), T37 (≠ R51), L58 (≠ F73), D59 (= D74), V60 (= V75), N86 (= N101), A87 (= A102), G88 (= G103), I89 (≠ L104), I136 (≠ L152), Y151 (= Y167), K155 (= K171), P181 (= P197)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
27% identity, 85% coverage: 21:246/267 of query aligns to 7:238/244 of 6t62A
- active site: G16 (= G30), S138 (= S154), Y151 (= Y167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G26), S14 (≠ T28), R15 (≠ A29), A36 (≠ G50), T37 (≠ R51), L58 (≠ F73), D59 (= D74), V60 (= V75), N86 (= N101), A87 (= A102), G88 (= G103), I89 (≠ L104), I136 (≠ L152), S137 (≠ G153), S138 (= S154), Y151 (= Y167), K155 (= K171), P181 (= P197), G182 (= G198), I184 (≠ A200), M188 (≠ F204)
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
30% identity, 84% coverage: 15:239/267 of query aligns to 9:247/268 of 2rh4B
- active site: G24 (= G30), N121 (= N126), S151 (= S154), Y164 (= Y167), K168 (= K171), Y209 (≠ G210)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G26), T22 (= T28), S23 (≠ A29), I25 (≠ F31), A44 (≠ G50), R45 (= R51), G46 (≠ R52), C69 (≠ L69), D70 (= D74), V71 (= V75), N97 (= N101), S151 (= S154), Y164 (= Y167), K168 (= K171), G195 (= G198), V197 (≠ A200), T199 (≠ S202), M201 (≠ F204)
Query Sequence
>8499632 FitnessBrowser__Miya:8499632
MTATAATTRATSAPSTSRGGIVCITGATAGFGAATARRFAAEGWRIIATGRRQDRLDALV
TELGDGNCLPLCFDVRDGDAVQAALGNLPEAWRAVDVLVNNAGLALGLEPAHRCSMDDWM
TMVDTNIKGLLHVTRALLPGMVERGRGHVVNLGSITGTYAYPGANVYGGTKAFVMQFSRG
LRADLHGTGVRVTNIEPGLAESEFSVVRFGGDADRVAKLYEGASALRPEDIADTIAWAVS
CPAHVNVNRIEVMPTSQSFGALPVHRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory