SitesBLAST
Comparing 8499635 FitnessBrowser__Miya:8499635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
43% identity, 98% coverage: 4:305/307 of query aligns to 5:306/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G12), P14 (= P13), A15 (= A14), E34 (= E33), Q35 (≠ K34), G40 (= G39), Q41 (= Q40), T45 (= T44), N50 (= N49), V82 (= V82), T110 (≠ S110), G111 (= G111), Y114 (= Y114), C136 (= C136), V242 (= V241), G275 (= G274), D276 (= D275), Q284 (= Q283), I285 (≠ V284)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
41% identity, 98% coverage: 4:305/307 of query aligns to 2:303/303 of 5mh4A
- active site: V34 (≠ S36), P35 (= P37), M39 (≠ V41), E44 (= E46), C130 (= C133), C133 (= C136), D134 (= D137)
- binding flavin-adenine dinucleotide: G10 (= G12), P11 (= P13), A12 (= A14), E31 (= E33), R32 (≠ K34), G37 (= G39), Q38 (= Q40), T42 (= T44), N47 (= N49), G77 (≠ D80), V79 (= V82), T107 (≠ S110), G108 (= G111), E155 (= E158), V239 (= V241), F242 (= F244), G272 (= G274), D273 (= D275), Q281 (= Q283), I282 (≠ V284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (≠ V149), G147 (= G150), G148 (= G151), G149 (= G152), D150 (≠ N153), S151 (= S154), E154 (= E157), H170 (= H173), R171 (= R174), R172 (= R175), R176 (= R179), V234 (≠ I236), G235 (= G237), R280 (= R282), Q281 (= Q283)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
38% identity, 99% coverage: 2:305/307 of query aligns to 5:308/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G10), G15 (= G12), P16 (= P13), A17 (= A14), E36 (= E33), R37 (≠ K34), G42 (= G39), Q43 (= Q40), T47 (= T44), N52 (= N49), G82 (≠ D80), V84 (= V82), A111 (≠ C109), S112 (= S110), G113 (= G111), C138 (= C136), G277 (= G274), D278 (= D275), Q286 (= Q283), I287 (≠ V284)
- binding alpha-D-glucopyranose: R27 (= R24), D49 (≠ E46), K74 (≠ R72), F75 (≠ Y73), P122 (= P120), G123 (≠ D121), E126 (≠ R124), G129 (= G127), G131 (= G129), V132 (≠ I130), F143 (= F141), E206 (≠ K204), N208 (≠ H206)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
38% identity, 99% coverage: 2:305/307 of query aligns to 2:305/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G10), G12 (= G12), P13 (= P13), A14 (= A14), E33 (= E33), R34 (≠ K34), G39 (= G39), Q40 (= Q40), T44 (= T44), N49 (= N49), G79 (≠ D80), D80 (≠ A81), V81 (= V82), S109 (= S110), G110 (= G111), Y113 (= Y114), C135 (= C136), G274 (= G274), D275 (= D275), Q283 (= Q283), I284 (≠ V284)
- binding alpha-D-glucopyranose: D46 (≠ E46), E48 (= E48), G126 (= G127), G128 (= G129), D136 (= D137), A138 (≠ N139), F139 (= F140), F139 (= F140), F140 (= F141)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G151), G151 (= G152), D152 (≠ N153), S153 (= S154), E156 (= E157), H172 (= H173), R173 (= R174), R174 (= R175), R178 (= R179), I236 (= I236)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
39% identity, 99% coverage: 4:306/307 of query aligns to 5:307/309 of 4gcmB
- active site: C133 (= C133), C136 (= C136), D137 (= D137)
- binding flavin-adenine dinucleotide: G11 (= G10), G13 (= G12), P14 (= P13), A15 (= A14), E34 (= E33), R35 (≠ K34), G40 (= G39), Q41 (= Q40), T45 (= T44), N50 (= N49), D81 (≠ A81), I82 (≠ V82), T110 (≠ S110), G111 (= G111), C136 (= C136), G275 (= G274), D276 (= D275), Q284 (= Q283), I285 (≠ V284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ L117), G151 (= G151), G152 (= G152), D153 (≠ N153), S154 (= S154), E157 (= E157), R174 (= R174), R175 (= R175), R179 (= R179), Q181 (≠ C181), I237 (= I236)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
39% identity, 95% coverage: 4:295/307 of query aligns to 8:303/313 of 2q7vA
- active site: P41 (= P37), I45 (≠ V41), E50 (= E46), C141 (= C133), C144 (= C136), D145 (= D137)
- binding flavin-adenine dinucleotide: G16 (= G12), P17 (= P13), A18 (= A14), E37 (= E33), K38 (= K34), G43 (= G39), Q44 (= Q40), I45 (≠ V41), N53 (= N49), E85 (≠ A81), V86 (= V82), T118 (≠ S110), G119 (= G111), C144 (= C136), G282 (= G274), D283 (= D275), Q291 (= Q283), L292 (≠ V284), S295 (≠ A287)
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
39% identity, 98% coverage: 5:304/307 of query aligns to 7:308/313 of 2a87A
- active site: F39 (≠ P37), L43 (≠ V41), D48 (≠ E46), C136 (= C133), C139 (= C136), D140 (= D137)
- binding flavin-adenine dinucleotide: G12 (= G10), S13 (≠ G11), G14 (= G12), P15 (= P13), A16 (= A14), F34 (≠ V32), E35 (= E33), G36 (≠ K34), G40 (= G38), G41 (= G39), A42 (≠ Q40), L43 (≠ V41), T46 (= T44), V49 (≠ I47), N51 (= N49), D83 (= D80), V84 (≠ A81), M113 (≠ S110), C139 (= C136), G278 (= G274), D279 (= D275), R286 (= R282), Q287 (= Q283), A288 (≠ V284), V289 (≠ T285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L117), G155 (= G152), D156 (≠ N153), S157 (= S154), H176 (= H173), R177 (= R174), R178 (= R175), R182 (= R179), I239 (= I236), Y259 (≠ F256), R283 (≠ K279), R286 (= R282)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
39% identity, 98% coverage: 5:304/307 of query aligns to 16:317/335 of P9WHH1
- SGPA 22:25 (≠ GGPA 11:14) binding
- Y32 (= Y21) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 33:40, 50% identical) binding
- N60 (= N49) binding
- V93 (≠ A81) binding
- C145 (= C133) modified: Disulfide link with 148, Redox-active
- C148 (= C136) modified: Disulfide link with 145, Redox-active
- S166 (= S154) binding
- H185 (= H173) binding
- R191 (= R179) binding
- I248 (= I236) binding
- Y268 (≠ F256) binding
- D288 (= D275) binding
- R295 (= R282) binding
- RQAV 295:298 (≠ RQVT 282:285) binding
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
39% identity, 98% coverage: 4:304/307 of query aligns to 3:304/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (= I9), G9 (= G10), S10 (≠ G11), G11 (= G12), P12 (= P13), A13 (= A14), E32 (= E33), G33 (≠ K34), Q35 (≠ S36), G38 (= G39), A39 (≠ Q40), L40 (≠ V41), T43 (= T44), N48 (= N49), D80 (≠ A81), V81 (= V82), M109 (≠ S110), G110 (= G111), T131 (≠ Y132), C135 (= C136), G274 (= G274), D275 (= D275), R282 (= R282), Q283 (= Q283), A284 (≠ V284), A287 (= A287)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ K115), H115 (≠ K116), L116 (= L117), R173 (= R174), E200 (≠ V201), I201 (≠ V202), I235 (= I236)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
39% identity, 98% coverage: 4:304/307 of query aligns to 3:304/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (= I9), G9 (= G10), S10 (≠ G11), G11 (= G12), P12 (= P13), A13 (= A14), E32 (= E33), G33 (≠ K34), Q35 (≠ S36), G38 (= G39), A39 (≠ Q40), L40 (≠ V41), T43 (= T44), N48 (= N49), D80 (≠ A81), V81 (= V82), M109 (≠ S110), G110 (= G111), T131 (≠ Y132), C135 (= C136), G274 (= G274), D275 (= D275), R282 (= R282), Q283 (= Q283), A284 (≠ V284), A287 (= A287)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L117), R173 (= R174), E200 (≠ V201), I201 (≠ V202)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
39% identity, 98% coverage: 4:304/307 of query aligns to 3:304/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G10), S10 (≠ G11), G11 (= G12), P12 (= P13), A13 (= A14), E32 (= E33), G33 (≠ K34), Q35 (≠ S36), G38 (= G39), A39 (≠ Q40), L40 (≠ V41), T43 (= T44), N48 (= N49), D80 (≠ A81), V81 (= V82), M109 (≠ S110), G110 (= G111), T131 (≠ Y132), C135 (= C136), G274 (= G274), D275 (= D275), R282 (= R282), Q283 (= Q283), A284 (≠ V284), A287 (= A287)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ K115), H115 (≠ K116), L116 (= L117), V148 (= V149), R173 (= R174), E200 (≠ V201), I201 (≠ V202)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
39% identity, 98% coverage: 4:304/307 of query aligns to 3:304/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (= I9), G9 (= G10), S10 (≠ G11), G11 (= G12), P12 (= P13), A13 (= A14), E32 (= E33), G33 (≠ K34), Q35 (≠ S36), G38 (= G39), A39 (≠ Q40), L40 (≠ V41), T43 (= T44), N48 (= N49), D80 (≠ A81), V81 (= V82), M109 (≠ S110), G110 (= G111), T131 (≠ Y132), C135 (= C136), G274 (= G274), D275 (= D275), R282 (= R282), Q283 (= Q283), A284 (≠ V284), A287 (= A287)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G151), G151 (= G152), D152 (≠ N153), S153 (= S154), E156 (= E157), H172 (= H173), R173 (= R174), R174 (= R175), R178 (= R179), I235 (= I236)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
39% identity, 98% coverage: 4:304/307 of query aligns to 4:305/306 of 5uthA
- active site: C133 (= C133), C136 (= C136), D137 (= D137)
- binding flavin-adenine dinucleotide: I9 (= I9), G10 (= G10), S11 (≠ G11), G12 (= G12), P13 (= P13), A14 (= A14), F32 (≠ V32), E33 (= E33), G34 (≠ K34), Q36 (≠ S36), G39 (= G39), A40 (≠ Q40), L41 (≠ V41), N49 (= N49), D81 (≠ A81), V82 (= V82), M110 (≠ S110), G111 (= G111), C136 (= C136), G275 (= G274), D276 (= D275), R283 (= R282), Q284 (= Q283), A285 (≠ V284), A288 (= A287)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
39% identity, 98% coverage: 4:304/307 of query aligns to 7:309/310 of 3f8pD
- active site: C135 (= C133), C138 (= C136), D139 (= D137)
- binding nicotinamide-adenine-dinucleotide: V12 (≠ I9), G13 (= G10), L14 (≠ G11), G15 (= G12), P16 (= P13), A17 (= A14), G36 (≠ E33), T38 (≠ S36), G41 (= G39), Q42 (= Q40), I82 (≠ A81), V83 (= V82), G111 (≠ C109), I112 (≠ S110), G113 (= G111), G277 (= G274), D278 (= D275)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
38% identity, 97% coverage: 5:302/307 of query aligns to 71:377/515 of Q70G58
- C203 (= C133) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C136) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A155) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H173) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R174) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
3r9uA Thioredoxin-disulfide reductase from campylobacter jejuni.
39% identity, 98% coverage: 5:305/307 of query aligns to 6:314/314 of 3r9uA
- active site: C137 (= C133), C140 (= C136), D141 (= D137)
- binding flavin-adenine dinucleotide: G11 (= G10), G12 (= G11), G13 (= G12), P14 (= P13), A15 (= A14), F34 (≠ V32), E35 (= E33), K36 (= K34), G41 (= G39), Q42 (= Q40), I43 (≠ V41), N51 (= N49), G83 (≠ N79), V84 (≠ A81), T114 (≠ S110), G115 (= G111), T158 (≠ S154), R245 (≠ V241), G283 (= G274), D284 (= D275), K291 (≠ R282), Q292 (= Q283), V293 (= V284), A296 (= A287)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
38% identity, 98% coverage: 4:304/307 of query aligns to 7:307/308 of 3f8rA
- active site: C133 (= C133), C136 (= C136), D137 (= D137)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (≠ I9), G13 (= G10), L14 (≠ G11), G15 (= G12), P16 (= P13), A17 (= A14), E37 (≠ K34), T38 (≠ S36), G41 (= G39), Q42 (= Q40), I82 (≠ A81), V83 (= V82), G109 (≠ C109), I110 (≠ S110), G111 (= G111), R115 (≠ K115), L117 (= L117), D153 (≠ N153), S154 (= S154), E157 (= E157), R174 (= R174), R175 (= R175), Y184 (= Y184), I236 (= I236), G275 (= G274), D276 (= D275), L282 (vs. gap), G283 (≠ A280), R285 (= R282)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
36% identity, 96% coverage: 4:298/307 of query aligns to 6:300/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G10), G14 (= G12), P15 (= P13), A16 (= A14), F34 (≠ V32), E35 (= E33), K36 (= K34), G41 (= G39), A42 (≠ Q40), V83 (= V82), T112 (≠ S110), G113 (= G111), G276 (= G274), D277 (= D275)
- binding nicotinamide-adenine-dinucleotide: G153 (= G151), G154 (= G152), S156 (= S154), Q175 (≠ H173), N176 (≠ R174), T181 (≠ R179), V238 (≠ I236)
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
36% identity, 97% coverage: 5:302/307 of query aligns to 3:304/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G10), S9 (≠ G11), G10 (= G12), P11 (= P13), A12 (= A14), E31 (= E33), G32 (vs. gap), N35 (≠ L35), G36 (≠ S36), G39 (= G39), Q40 (= Q40), L41 (≠ V41), T44 (= T44), N49 (= N49), D81 (≠ A81), V82 (= V82), A109 (≠ C109), T110 (≠ S110), W126 (≠ I126), S136 (≠ C136), G276 (= G274), D277 (= D275), R284 (= R282), Q285 (= Q283), A286 (≠ V284), A289 (= A287)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
38% identity, 98% coverage: 4:304/307 of query aligns to 7:307/308 of 3f8dA
- active site: C133 (= C133), A136 (≠ C136), D137 (= D137)
- binding flavin-adenine dinucleotide: V12 (≠ I9), G13 (= G10), L14 (≠ G11), G15 (= G12), P16 (= P13), A17 (= A14), G36 (≠ E33), E37 (≠ K34), T38 (≠ S36), G41 (= G39), Q42 (= Q40), E45 (≠ M43), A46 (≠ T44), V49 (≠ I47), D51 (≠ N49), I82 (≠ A81), V83 (= V82), G109 (≠ C109), I110 (≠ S110), G111 (= G111), C133 (= C133), A136 (≠ C136), G275 (= G274), D276 (= D275), R285 (= R282), Q286 (= Q283), V287 (= V284)
Query Sequence
>8499635 FitnessBrowser__Miya:8499635
MKTYDAIVIGGGPAGMTAALYLLRSGVSVAFVEKLSPGGQVLMTAEIENYPGFPKGIQGW
ELADLFAAHLERYPHDKYNDAVTAFEPAPGANRVRVGDEWIVGKTVVVCSGARYKKLGLP
DEDRLIGKGISYCALCDGNFFRGQKVGVVGGGNSALEESLYLAKLVANLHLIHRRDEFRG
CKCYQEKVQSAPNIDIEFSSVVRKLHGDTGLTGITLADVKTGEERFLPLDGLFIFIGFEP
VGDFLPDGIDKDPQGFIITDTEMRTSLPGVFAAGDIRSKACRQVTTAVGDGATAATAAFT
YLEQLDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory