SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 8499659 FitnessBrowser__Miya:8499659 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 1 hits to proteins with known functional sites (download)

O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
33% identity, 93% coverage: 2:140/149 of query aligns to 501:640/650 of O31645

query
sites
O31645
R
 
K
L
 
L
S
 
T
E
 
D
Y
 
I
L
 
I
H
 
S
D
 
P
D
 
E
L
 
L
I
 
I
L
 
E
P
 
P
E
 
N
L
 
L
S
 
S
A
 
G
G
 
E
T
 
T
K
 
S
K
 
D
E
 
D
V
 
I
L
 
I
A
 
D
E
 
E
L
 
L
V
 
I
Q
 
Q
A
 
K
V
 
L
V
 
S
R
 
R
R
 
R
H
 
G
P
 
A
E
 
L
V
 
L
D
 
S
A
 
E
A
 
S
V
 
G
A
 
F
L
 
K
G
 
Q
V
 
A
L
 
I
N
 
L
D
 
N
R
 
R
E
 
E
S
 
Q
L
 
Q
G
 
G
T
 
T
T
 
T
G
 
A
I
 
I
G
 
G
D
 
M
G
 
N
V
 
I
A
 
A
I
 
I
P
 
P
H
 
H
G
 
G
K
 
K
L
 
S
A
 
E
N
 
A
I
 
V
S
 
R
D
 
E
I
 
P
V
 
S
V
 
V
I
 
A
V
 
F
G
 
G
R
 
I
S
 
K
V
 
R
P
 
S
G
 
G
I
 
V
D
 
D
F
 
W
D
 
N
A
 
S
L
 
L
D
 
D
M
 
G
K
 
S
P
 
E
C
 
A
H
 
K
L
 
L
F
 
I
F
 
F
L
 
M
V
 
I
L
 
A
A
 
V
P
 
P
E
 
K
Q
 
E
V
 
S
A
 
G
G
 
G
-
 
N
M
 
Q
H
 
H
L
 
L
R
 
K
I
 
I
L
 
L
A
 
Q
H
 
M
I
 
L
S
 
S
R
 
R
L
 
K
L
 
L
K
 
M
D
 
D
P
 
D
Q
 
N
F
 
Y
R
 
R
R
 
E
A
 
R
M
 
L
I
 
L
A
 
S
A
 
V
Q
 
Q
D
 
T
G
 
T
E
 
E

Sites not aligning to the query:

Query Sequence

>8499659 FitnessBrowser__Miya:8499659
MRLSEYLHDDLILPELSAGTKKEVLAELVQAVVRRHPEVDAAVALGVLNDRESLGTTGIG
DGVAIPHGKLANISDIVVIVGRSVPGIDFDALDMKPCHLFFLVLAPEQVAGMHLRILAHI
SRLLKDPQFRRAMIAAQDGEAFRAIMRTT

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory