SitesBLAST
Comparing 8499708 FitnessBrowser__Miya:8499708 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
6addA The crystal structure of rv2747 from mycobacterium tuberculosis in complex with coa and nlq (see paper)
37% identity, 85% coverage: 3:134/155 of query aligns to 3:134/168 of 6addA
- binding coenzyme a: Y24 (≠ T24), I28 (≠ L29), V75 (≠ L75), A76 (≠ V76), V77 (= V77), T82 (≠ R82), G83 (= G83), H84 (≠ K84), G85 (= G85), G87 (= G87), H88 (≠ R88), T110 (= T110), E112 (≠ Q112), F115 (= F115)
- binding n~2~-acetyl-l-glutamine: K27 (≠ Q27), I28 (≠ L29), L30 (= L31), T74 (≠ S74), L109 (= L109)
Sites not aligning to the query:
5yo2A The crystal structure of rv2747 from mycobacterium tuberculosis in complex with acetyl coa and l-arginine (see paper)
37% identity, 85% coverage: 3:134/155 of query aligns to 3:134/168 of 5yo2A
- binding acetyl coenzyme *a: Y24 (≠ T24), I28 (≠ L29), I72 (≠ V72), R73 (= R73), T74 (≠ S74), V75 (≠ L75), V77 (= V77), T82 (≠ R82), G83 (= G83), H84 (≠ K84), G85 (= G85), G87 (= G87), H88 (≠ R88), T110 (= T110), E112 (≠ Q112), F115 (= F115), F116 (= F116)
- binding arginine: G26 (= G26), L29 (= L30), L30 (= L31), R73 (= R73), L109 (= L109)
Sites not aligning to the query:
5ygeA Arga complexed with acecoa and glutamate (see paper)
37% identity, 85% coverage: 3:134/155 of query aligns to 4:135/169 of 5ygeA
- binding acetyl coenzyme *a: Y25 (≠ T24), I73 (≠ V72), V76 (≠ L75), A77 (≠ V76), V78 (= V77), T83 (≠ R82), G84 (= G83), H85 (≠ K84), G86 (= G85), G88 (= G87), H89 (≠ R88), T111 (= T110), E113 (≠ Q112), F117 (= F116)
- binding glutamic acid: K33 (≠ R33), E44 (≠ D44), H64 (≠ S63), R74 (= R73)
Sites not aligning to the query:
4i49A Structure of ngnags bound with bisubstrate analog coa-NAG (see paper)
35% identity, 85% coverage: 6:136/155 of query aligns to 277:407/424 of 4i49A
- binding (2S)-2-({(3S,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14,20-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaicosan-20-yl}amino)pentanedioic acid (non-preferred name): I300 (≠ L29), L301 (= L30), L302 (= L31), R304 (= R33), A343 (≠ R73), C344 (≠ S74), L345 (= L75), A346 (≠ V76), V347 (= V77), Q352 (≠ R82), D353 (≠ G83), G355 (= G85), G357 (= G87), E358 (≠ R88), L379 (= L109), S380 (≠ T110), T383 (≠ V113), W386 (≠ F115), F387 (= F116)
Sites not aligning to the query:
- binding (2S)-2-({(3S,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14,20-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaicosan-20-yl}amino)pentanedioic acid (non-preferred name): 413, 415
3d2mA Crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-glutamate (see paper)
35% identity, 85% coverage: 6:136/155 of query aligns to 277:407/424 of 3d2mA
- binding coenzyme a: L345 (= L75), V347 (= V77), Q352 (≠ R82), D353 (≠ G83), G355 (= G85), G357 (= G87), E358 (≠ R88), S380 (≠ T110), T383 (≠ V113), W386 (≠ F115)
- binding glutamic acid: L302 (= L31), R304 (= R33), A343 (≠ R73), C344 (≠ S74), L379 (= L109)
Sites not aligning to the query:
3b8gA Crysta structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and n-acetyl-glutamate (see paper)
35% identity, 85% coverage: 6:136/155 of query aligns to 277:407/424 of 3b8gA
- binding coenzyme a: I300 (≠ L29), L345 (= L75), V347 (= V77), Q352 (≠ R82), D353 (≠ G83), G355 (= G85), Y356 (≠ W86), G357 (= G87), E358 (≠ R88), S380 (≠ T110), T383 (≠ V113), E385 (= E114), W386 (≠ F115)
- binding n-acetyl-l-glutamate: L302 (= L31), R304 (= R33), A343 (≠ R73), C344 (≠ S74), L379 (= L109)
Sites not aligning to the query:
2r8vA Native structure of n-acetylglutamate synthase from neisseria gonorrhoeae (see paper)
35% identity, 85% coverage: 6:136/155 of query aligns to 277:407/424 of 2r8vA
- binding acetyl coenzyme *a: I300 (≠ L29), L301 (= L30), L345 (= L75), V347 (= V77), Q352 (≠ R82), D353 (≠ G83), G355 (= G85), G357 (= G87), E358 (≠ R88), T383 (≠ V113), E385 (= E114), W386 (≠ F115), F387 (= F116)
Sites not aligning to the query:
3d2pA Crystal structure of n-acetylglutamate synthase from neisseria gonorrhoeae complexed with coenzyme a and l-arginine (see paper)
33% identity, 85% coverage: 6:136/155 of query aligns to 285:411/424 of 3d2pA
Sites not aligning to the query:
- active site: 26
- binding arginine: 13, 197, 216, 253, 266, 267, 269, 270, 271, 274, 276
P0A6C5 Amino-acid acetyltransferase; N-acetylglutamate synthase; AGS; NAGS; EC 2.3.1.1 from Escherichia coli (strain K12) (see paper)
30% identity, 81% coverage: 6:131/155 of query aligns to 298:423/443 of P0A6C5
Sites not aligning to the query:
- 15 H→Y: In EE17.
- 19 Y→C: In EE51.
- 54 S→N: In PT2M217.
- 58 R→H: In EE11.
- 287 G→S: In PT2M216.
- 432 Q→R: In PT2M217.
Query Sequence
>8499708 FitnessBrowser__Miya:8499708
MGQPYIRKARVQDVKPIHALLMHTSGQGLLLPRSLNQLYSHLRDFLVIDPDDGGPLVGCC
ALSIAWDDIAEVRSLVVADDLRGKGWGRKLVDACLSDAVTLGIFRVFALTYQVEFFLRMG
FRVVEKDVLPQKIWADCIHCPKFPDCDETAVLLEM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory