Comparing 8499710 FitnessBrowser__Miya:8499710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
32% identity, 98% coverage: 10:814/818 of query aligns to 10:832/841 of 8g3hA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 97% coverage: 12:805/818 of query aligns to 15:855/1227 of P13009
Sites not aligning to the query:
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
36% identity, 68% coverage: 8:566/818 of query aligns to 10:555/559 of 1q8jA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
36% identity, 68% coverage: 8:566/818 of query aligns to 10:555/560 of 3bofA
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
29% identity, 99% coverage: 6:815/818 of query aligns to 23:897/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
28% identity, 69% coverage: 6:569/818 of query aligns to 7:593/611 of 4cczA
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
39% identity, 25% coverage: 612:816/818 of query aligns to 8:215/215 of 7xcnP
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
35% identity, 25% coverage: 614:814/818 of query aligns to 6:206/507 of 8sseA
Sites not aligning to the query:
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
33% identity, 31% coverage: 325:579/818 of query aligns to 12:268/271 of 2ycjA
2yciX Methyltransferase native (see paper)
33% identity, 31% coverage: 325:579/818 of query aligns to 12:268/271 of 2yciX
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
36% identity, 23% coverage: 624:812/818 of query aligns to 16:202/206 of 4jgiB
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
33% identity, 31% coverage: 325:579/818 of query aligns to 13:269/272 of 2yckX
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
33% identity, 31% coverage: 325:580/818 of query aligns to 3:260/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
33% identity, 31% coverage: 325:580/818 of query aligns to 3:260/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
33% identity, 31% coverage: 325:580/818 of query aligns to 3:260/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
33% identity, 31% coverage: 325:580/818 of query aligns to 3:260/262 of 2e7fA
Q46389 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase; 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase; MeTr; EC 2.1.1.258 from Moorella thermoacetica (Clostridium thermoaceticum) (see 2 papers)
33% identity, 31% coverage: 325:580/818 of query aligns to 3:260/262 of Q46389
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
38% identity, 22% coverage: 614:796/818 of query aligns to 9:193/212 of 3ezxA
Sites not aligning to the query:
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
32% identity, 23% coverage: 614:805/818 of query aligns to 13:205/246 of 1bmtA
Sites not aligning to the query:
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
45% identity, 14% coverage: 699:815/818 of query aligns to 7:125/125 of 1y80A
>8499710 FitnessBrowser__Miya:8499710
MPDFRQALRSGRRLVFDGGMGTMLQSRGLPPGVSPELFCLARPDVLVGIHADYLRAGADV
LTTNTFGGCIHKLGTGPGAPDVVEFNRAMARAAREAVLASGREAFVAGSVGPSGHFMRPL
GDLDPAELVAAFRAQIRGLVQGGVDLILAETQFDLAEARAIVLAARAECDLPVGVSMTFE
NGVSLTGTRPEVFVQSMLNMGVDLVGTNCSAGPEQMAEVADELLAISEVPVLVEPNAGLP
ELVDGKTVFRLGPDDFARHTARFAASGVRMLGGCCGTTPDHIAALRGALDNLSGGLVPDP
ARRDGIVLTTRAQAVHIGAGSPIRIIGERINPTGKKLLTAELQAGEFAQALRFADEQVEA
GAPLLDVNVGAPMVDEAVLLPALVERLVARHSLPLSLDSSNADAIAAALPFHPGSPLVNS
ISGEPGRMEHLGPLCRDHGAPFILLPLKGRKLPVTAAERIAIIEELLQQADSLRIPRRLV
MVDVLALAVSSKAEAARHCLDTIRWCAAQGLPTTIGLSNISFGLPARELLNSTFLAMAAG
AGLSSCIAHPGNARIREAVAASSVLLGLDANAESFIEGYSGWTPGGDATGATPAGVAGGT
GGGTGGVKAKAATLEEAVIRGDREGALALVERALSEGADPFSLVQEKLIPGITEVGRRYE
RREYFLPQLIRSAETMQHAFRKLQPLLEAQRGHEARPVIIMATVEGDIHDIGKNIVTLML
GNHGFDVVDLGKDVKAADIVEAAERHGARVIGLSALMTTTMVRMEDTVRLVRERGLPVKV
MVGGAVVTPAYAEAIGADGYSADAVEAVRVAKELLTVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory