Comparing 8499715 FitnessBrowser__Miya:8499715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ph4A Clostridium thermocellum ribose-5-phosphate isomerase b with d-allose (see paper)
51% identity, 88% coverage: 7:138/150 of query aligns to 5:137/148 of 3ph4A
3ph3A Clostridium thermocellum ribose-5-phosphate isomerase b with d-ribose (see paper)
51% identity, 88% coverage: 7:138/150 of query aligns to 5:137/148 of 3ph3A
3heeA Structural study of clostridium thermocellum ribose-5-phosphate isomerase b and ribose-5-phosphate (see paper)
51% identity, 88% coverage: 7:138/150 of query aligns to 5:137/148 of 3heeA
6mu0A Crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate
48% identity, 93% coverage: 1:140/150 of query aligns to 2:144/152 of 6mu0A
P37351 Ribose-5-phosphate isomerase B; Phosphoriboisomerase B; EC 5.3.1.6 from Escherichia coli (strain K12) (see paper)
47% identity, 91% coverage: 4:139/150 of query aligns to 3:139/149 of P37351
3k8cA Complex of trypanosoma cruzi ribose 5-phosphate isomerase type b with 4-deoxy-4-phospho-d-erythronohydroxamic acid (see paper)
47% identity, 94% coverage: 1:141/150 of query aligns to 1:145/152 of 3k8cA
3k7sA Complex of trypanosoma cruzi ribose 5-phosphate isomerase type b with ribose 5-phosphate (see paper)
47% identity, 94% coverage: 1:141/150 of query aligns to 1:145/152 of 3k7sA
3k7pA Structure of mutant of ribose 5-phosphate isomerase type b from trypanosoma cruzi. (see paper)
46% identity, 94% coverage: 1:141/150 of query aligns to 1:145/153 of 3k7pA
P9WKD7 Ribose-5-phosphate isomerase B; Phosphoriboisomerase B; EC 5.3.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
42% identity, 90% coverage: 5:139/150 of query aligns to 6:143/162 of P9WKD7
2vvqA Crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with the inhibitor 5-deoxy-5-phospho-d- ribonate (see paper)
42% identity, 90% coverage: 5:139/150 of query aligns to 4:141/156 of 2vvqA
2vvoA Crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with alpha d-allose 6-phosphate (see paper)
42% identity, 90% coverage: 5:139/150 of query aligns to 4:141/156 of 2vvoA
1uslA Structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, complexed with phosphate. (see paper)
42% identity, 90% coverage: 5:139/150 of query aligns to 4:141/156 of 1uslA
2vvpA Crystal structure of mycobacterium tuberculosis ribose-5-phosphate isomerase b in complex with its substrates ribose 5-phosphate and ribulose 5-phosphate (see paper)
42% identity, 90% coverage: 5:139/150 of query aligns to 4:141/157 of 2vvpA
2betA Structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronate. (see paper)
42% identity, 90% coverage: 5:139/150 of query aligns to 4:141/157 of 2betA
2besC Structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, in complex with 4-phospho-d-erythronohydroxamic acid. (see paper)
42% identity, 90% coverage: 5:139/150 of query aligns to 4:141/158 of 2besC
4lfnA Crystal structure of d-galactose-6-phosphate isomerase in complex with d-ribulose (see paper)
32% identity, 92% coverage: 5:142/150 of query aligns to 3:139/142 of 4lfnA
4lfmA Crystal structure of d-galactose-6-phosphate isomerase in complex with d-psicose (see paper)
32% identity, 92% coverage: 5:142/150 of query aligns to 3:139/142 of 4lfmA
4lflA Crystal structure of d-galactose-6-phosphate isomerase in complex with d-tagatose-6-phosphate (see paper)
32% identity, 92% coverage: 5:142/150 of query aligns to 3:139/142 of 4lflA
4lfnB Crystal structure of d-galactose-6-phosphate isomerase in complex with d-ribulose (see paper)
36% identity, 94% coverage: 5:145/150 of query aligns to 3:145/172 of 4lfnB
4lfmB Crystal structure of d-galactose-6-phosphate isomerase in complex with d-psicose (see paper)
36% identity, 94% coverage: 5:145/150 of query aligns to 3:145/172 of 4lfmB
>8499715 FitnessBrowser__Miya:8499715
MSAPVIIGSDHAGLALKQVIIAHLKATGRQVEDLGPQTAESCDYPLYAAKVTERVLATGG
FGILVCGTGIGMSMAANRFPGIRAALCTCEFHARATRQHNDANVLCLGERVTGPGVAMGL
VDLFLNTPFEGGRHQRRIDQFDGPACTGGC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory