Comparing 8499751 FitnessBrowser__Miya:8499751 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
38% identity, 98% coverage: 10:458/459 of query aligns to 6:447/448 of 6io1B
6s54A Transaminase from pseudomonas fluorescens (see paper)
37% identity, 96% coverage: 16:455/459 of query aligns to 12:449/453 of 6s54A
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
38% identity, 96% coverage: 16:457/459 of query aligns to 13:456/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 96% coverage: 16:457/459 of query aligns to 9:452/455 of 5kr5A
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
34% identity, 96% coverage: 16:457/459 of query aligns to 7:438/443 of 6fyqA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
34% identity, 92% coverage: 34:454/459 of query aligns to 25:442/453 of 6g4dB
Sites not aligning to the query:
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
34% identity, 92% coverage: 34:454/459 of query aligns to 25:442/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
34% identity, 92% coverage: 34:454/459 of query aligns to 25:442/451 of 6g4eA
Sites not aligning to the query:
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
33% identity, 98% coverage: 7:454/459 of query aligns to 1:444/454 of 7ypmA
5ghgB Transaminase w58l with smba
33% identity, 98% coverage: 9:457/459 of query aligns to 1:427/433 of 5ghgB
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 96% coverage: 16:457/459 of query aligns to 12:453/458 of 5kr3A
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
33% identity, 98% coverage: 7:454/459 of query aligns to 1:444/455 of 7ypnD
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
34% identity, 92% coverage: 35:454/459 of query aligns to 27:444/459 of D6R3B6
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
33% identity, 97% coverage: 16:459/459 of query aligns to 15:458/458 of 3fcrA
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
33% identity, 97% coverage: 12:454/459 of query aligns to 6:442/450 of 6gwiB
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 97% coverage: 16:459/459 of query aligns to 11:456/459 of 5kquC
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
32% identity, 97% coverage: 10:454/459 of query aligns to 3:435/443 of 7qx0B
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 79% coverage: 35:397/459 of query aligns to 70:436/504 of Q94CE5
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
32% identity, 91% coverage: 37:454/459 of query aligns to 3:414/422 of 7qx3A
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
33% identity, 95% coverage: 21:456/459 of query aligns to 11:445/447 of 5lhaA
>8499751 FitnessBrowser__Miya:8499751
MSPSLKHDPAAYAAADLAHVWHHLVQHQAFAGKGPMIVVEGEGLTLRDINGKEYLDATSG
GVWCVNVGYGRERIARAVYEQMKAMPYYAATAGNIPYIEFAQKLLAHMPGLTRAYLSNSG
SEANEKAYKMVRSLAHLSGNPAKKKILFRARDYHGTTLGALSSTGQAERKEWFGPLVPGF
VEFPHACCYRCAFNKTYPGCDIDCARAVERIIEQEGPETVGGLIVEPITAGGGVIPPVAE
YYTVLADICRRHGVLLIMDEVVCGMGRTGTMFGYQHYGVTPDIVTMAKGVASAYMPISVT
ATTEEVFKAFLNDPADKMAYFRDISTYGGCAAGCSAALENMAIIEEEKLLDNVNAMGDYL
LAGLKELGDLPYVGDVRGKGLLCGIELVQDKAGKKPMAEGKVIQVVGEMAANAVLVGRTN
RSLPGFNNIINIAPAYVVTRDNIDVILRTLRAALVKVLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory