SitesBLAST
Comparing 8499753 FitnessBrowser__Miya:8499753 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 82% coverage: 9:213/251 of query aligns to 5:218/375 of 2d62A
1g291 Malk (see paper)
36% identity, 80% coverage: 11:212/251 of query aligns to 4:214/372 of 1g291
- binding magnesium ion: D69 (= D75), E71 (≠ K77), K72 (≠ R78), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (≠ T45), G39 (= G46), C40 (= C47), G41 (= G48), K42 (= K49), T43 (= T50), T44 (= T51)
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
38% identity, 81% coverage: 10:212/251 of query aligns to 6:203/353 of 1vciA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 85% coverage: 1:213/251 of query aligns to 22:238/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
34% identity, 85% coverage: 1:213/251 of query aligns to 22:238/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
34% identity, 85% coverage: 1:213/251 of query aligns to 22:238/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ L23), S61 (≠ T45), G62 (= G46), G64 (= G48), K65 (= K49), S66 (≠ T50), T67 (= T51), Q111 (= Q86), K161 (≠ N136), Q162 (= Q137), S164 (= S139), G166 (≠ S141), M167 (= M142), Q188 (≠ E163), H221 (= H196)
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 80% coverage: 11:211/251 of query aligns to 18:221/378 of P69874
- C26 (≠ R19) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F20) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (= F38) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C47) mutation to T: Loss of ATPase activity and transport.
- L60 (= L53) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I69) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V125) mutation to M: Loss of ATPase activity and transport.
- D172 (= D162) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 81% coverage: 9:211/251 of query aligns to 1:206/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
32% identity, 81% coverage: 9:211/251 of query aligns to 1:206/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F20), S37 (≠ T45), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), Q81 (= Q86), R128 (≠ L133), A132 (≠ Q137), S134 (= S139), G136 (≠ S141), Q137 (≠ M142), E158 (= E163), H191 (= H196)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q86)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
32% identity, 81% coverage: 9:211/251 of query aligns to 1:206/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F20), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (≠ L133), S134 (= S139), Q137 (≠ M142)
- binding beryllium trifluoride ion: S37 (≠ T45), G38 (= G46), K41 (= K49), Q81 (= Q86), S134 (= S139), G136 (≠ S141), H191 (= H196)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q86)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
32% identity, 81% coverage: 9:211/251 of query aligns to 1:206/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F20), V17 (= V25), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (≠ L133), A132 (≠ Q137), S134 (= S139), Q137 (≠ M142)
- binding tetrafluoroaluminate ion: S37 (≠ T45), G38 (= G46), K41 (= K49), Q81 (= Q86), S134 (= S139), G135 (≠ A140), G136 (≠ S141), E158 (= E163), H191 (= H196)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q86)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
32% identity, 81% coverage: 9:211/251 of query aligns to 1:206/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F20), V17 (= V25), G38 (= G46), C39 (= C47), G40 (= G48), K41 (= K49), S42 (≠ T50), T43 (= T51), R128 (≠ L133), A132 (≠ Q137), S134 (= S139), Q137 (≠ M142)
- binding magnesium ion: S42 (≠ T50), Q81 (= Q86)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 81% coverage: 9:211/251 of query aligns to 2:207/371 of P68187
- A85 (≠ T89) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P110) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ L118) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ I121) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ D123) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T128) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (≠ S141) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D162) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
32% identity, 80% coverage: 11:211/251 of query aligns to 1:204/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F20), S35 (≠ T45), G36 (= G46), C37 (= C47), G38 (= G48), K39 (= K49), S40 (≠ T50), T41 (= T51), R126 (≠ L133), A130 (≠ Q137), S132 (= S139), G134 (≠ S141), Q135 (≠ M142)
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 73% coverage: 28:211/251 of query aligns to 22:208/393 of P9WQI3
- H193 (= H196) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 81% coverage: 9:211/251 of query aligns to 2:207/369 of P19566
- L86 (≠ C90) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P164) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D169) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
8hprD Lpqy-sugabc in state 4 (see paper)
34% identity, 73% coverage: 28:211/251 of query aligns to 21:207/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (≠ T45), C40 (= C47), G41 (= G48), K42 (= K49), S43 (≠ T50), T44 (= T51), Q82 (= Q86), R129 (≠ L133), Q133 (= Q137), S135 (= S139), G136 (≠ A140), G137 (≠ S141), Q159 (≠ E163), H192 (= H196)
- binding magnesium ion: S43 (≠ T50), Q82 (= Q86)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
34% identity, 73% coverage: 28:211/251 of query aligns to 21:207/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (≠ T45), G39 (= G46), G41 (= G48), K42 (= K49), S43 (≠ T50), Q82 (= Q86), Q133 (= Q137), G136 (≠ A140), G137 (≠ S141), Q138 (≠ M142), H192 (= H196)
- binding magnesium ion: S43 (≠ T50), Q82 (= Q86)
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
34% identity, 73% coverage: 28:211/251 of query aligns to 19:205/384 of 8hplC
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
35% identity, 81% coverage: 11:213/251 of query aligns to 4:214/230 of 6z4wA
Query Sequence
>8499753 FitnessBrowser__Miya:8499753
MQDAARPRTKIEVCNLTKRFGELLVLDDISFSVAEGEFVAIVGPTGCGKTTFLNALSCLL
PASNGQILIDGTPADPKRHNISYVFQEPTCLPWRTVRENVAYGMEVKGRPRKEIDERLDH
ILDMVGLTQCASLYPNQISASMQQRIAVSRAFAVDPDLLLMDEPYGQLDVKLRFYLEDEL
VNLWRKLRSTVLFITHNIEEAVYVSERILVLSNKPTRIKAEVKVDLPRPRDFMDPEFVRI
REHVTNLIRWW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory