Comparing 8499832 FitnessBrowser__Miya:8499832 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
43% identity, 80% coverage: 38:254/270 of query aligns to 17:223/241 of 4u00A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
39% identity, 86% coverage: 25:256/270 of query aligns to 6:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
39% identity, 86% coverage: 25:256/270 of query aligns to 6:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
39% identity, 86% coverage: 25:256/270 of query aligns to 6:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
39% identity, 86% coverage: 25:256/270 of query aligns to 6:227/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 80% coverage: 38:254/270 of query aligns to 16:223/240 of 4ymuJ
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 79% coverage: 33:246/270 of query aligns to 15:220/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
40% identity, 79% coverage: 33:246/270 of query aligns to 16:221/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
40% identity, 79% coverage: 33:246/270 of query aligns to 16:221/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
40% identity, 79% coverage: 33:246/270 of query aligns to 16:221/344 of 3tuiC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 82% coverage: 25:245/270 of query aligns to 4:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 82% coverage: 25:245/270 of query aligns to 4:223/230 of 1l2tA
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
34% identity, 83% coverage: 30:253/270 of query aligns to 11:225/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
34% identity, 83% coverage: 30:253/270 of query aligns to 11:225/229 of 6z67B
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
43% identity, 69% coverage: 25:209/270 of query aligns to 6:186/226 of 5xu1B
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 71% coverage: 54:246/270 of query aligns to 57:242/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 71% coverage: 54:246/270 of query aligns to 57:242/382 of 7aheC
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 85% coverage: 35:264/270 of query aligns to 23:246/265 of P07821
7ahdC Opua (e190q) occluded (see paper)
38% identity, 71% coverage: 54:246/270 of query aligns to 57:242/260 of 7ahdC
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
37% identity, 84% coverage: 23:248/270 of query aligns to 5:224/650 of 5ws4A
>8499832 FitnessBrowser__Miya:8499832
MHKATESASTSRRPACSAGDKSLVVENLRKEYTRGKPVLKNINLTVAGQCTTAIIGPSGT
GKSTLLRCINRLIEPTSGRILVSGQDICTLRGSDLRAARRRIGMVFQEYNLVERLSVMEN
VLCGRLGYISPWRAWLRKFPQEDIERAYDLLDMVGLTEFARARADELSGGQRQRVGIARA
VMQQPHILLADEPTSSLDPKTSVEIMELLREVASVNDIPVLVNIHDVTLGRRFADRVVGM
SKGDVVFDGVPGDLTDEHLKLIYGGEDWLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory