Comparing 8499838 FitnessBrowser__Miya:8499838 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
39% identity, 88% coverage: 17:352/382 of query aligns to 204:540/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
39% identity, 88% coverage: 17:352/382 of query aligns to 204:540/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
39% identity, 88% coverage: 17:352/382 of query aligns to 204:540/572 of 6n2nA
5b47A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
30% identity, 99% coverage: 3:381/382 of query aligns to 220:610/627 of 5b47A
5b46A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
30% identity, 99% coverage: 3:381/382 of query aligns to 220:610/627 of 5b46A
Q96XT2 2-oxoacid:ferredoxin oxidoreductase 2, subunit alpha; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
30% identity, 99% coverage: 3:381/382 of query aligns to 221:611/628 of Q96XT2
5b48A 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
30% identity, 99% coverage: 3:382/382 of query aligns to 188:563/576 of 5b48A
Q96Y66 2-oxoacid:ferredoxin oxidoreductase 1, subunit alpha; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
30% identity, 98% coverage: 8:382/382 of query aligns to 225:611/627 of Q96Y66
Sites not aligning to the query:
P72578 2-oxoacid:ferredoxin oxidoreductase subunit alpha; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see 2 papers)
30% identity, 98% coverage: 8:382/382 of query aligns to 225:611/632 of P72578
5exeA Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
27% identity, 95% coverage: 17:379/382 of query aligns to 8:369/394 of 5exeA
5exdD Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
27% identity, 95% coverage: 17:379/382 of query aligns to 8:369/394 of 5exdD
5c4iA Structure of an oxalate oxidoreductase (see paper)
27% identity, 95% coverage: 17:379/382 of query aligns to 8:369/394 of 5c4iA
Q2RMD6 Pyruvate:ferredoxin oxidoreductase; PFOR; Pyruvate synthase; EC 1.2.7.1 from Moorella thermoacetica (strain ATCC 39073 / JCM 9320) (see paper)
24% identity, 75% coverage: 36:322/382 of query aligns to 26:306/1171 of Q2RMD6
Sites not aligning to the query:
6ciqA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with coenzyme a bound (see paper)
24% identity, 75% coverage: 36:322/382 of query aligns to 25:305/1169 of 6ciqA
Sites not aligning to the query:
6cinB Crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica (see paper)
24% identity, 75% coverage: 36:322/382 of query aligns to 25:305/1169 of 6cinB
Sites not aligning to the query:
6cipA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound (see paper)
24% identity, 75% coverage: 36:322/382 of query aligns to 25:305/1165 of 6cipA
Sites not aligning to the query:
6cioA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with lactyl-tpp bound (see paper)
24% identity, 75% coverage: 36:322/382 of query aligns to 25:305/1164 of 6cioA
Sites not aligning to the query:
>8499838 FitnessBrowser__Miya:8499838
MAVQRKKRKRRELFALGNEAVAEGALLAGCSFYAGYPITPSTEIMEVMANRLPLIEDGVF
IQMEDEIASMGATIGASLAGRKAMTATSGPGFALMQEHIGYACMVEAPLVVVNVMRGGPS
TGLPTSPAQADVQMARWGTHGDHPIIVLSASNVQECLEMTVTAFNFAEKYRTPVILLLDE
VTAHTREKITVPDPDEVEILSRVEPTVPPEWFKPYADTARGVPAMAPIGSGYRTHVTGLT
HDVMGYPTQRPDEVKDAMLRLFRKIDQYYGDIQMSDEYMLDDAEVAVVAYGSVARSAHLA
VEQARERGAKAGLLTLKTLFPFPRPAVEKLTHRCHTVVVPEMNMGQMSREVKRVNNGRTK
VRTINRVDGQIITPSEILKAIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory