SitesBLAST
Comparing 8499839 FitnessBrowser__Miya:8499839 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5b46B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
35% identity, 88% coverage: 22:264/277 of query aligns to 8:264/301 of 5b46B
- binding magnesium ion: D87 (= D99), N115 (= N127), V117 (≠ I129)
- binding iron/sulfur cluster: W8 (≠ F22), C9 (= C23), C12 (= C26), C43 (= C57), C194 (= C206), T196 (= T208), Y197 (≠ Q209)
- binding thiamine diphosphate: I41 (= I55), G42 (= G56), C43 (= C57), S44 (= S58), H62 (= H74), G86 (= G98), G88 (= G100), D89 (= D101), N115 (= N127), V117 (≠ I129), Y118 (= Y130), G119 (= G131), L120 (≠ M132), T121 (= T133)
Q96XT4 2-oxoacid:ferredoxin oxidoreductase 2, subunit beta; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
35% identity, 88% coverage: 22:264/277 of query aligns to 11:267/304 of Q96XT4
6n2oD 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
34% identity, 95% coverage: 14:275/277 of query aligns to 16:277/291 of 6n2oD
- binding magnesium ion: D101 (= D99), N129 (= N127), I131 (= I129)
- binding succinyl-coenzyme a: I57 (= I55), R62 (= R60), L134 (≠ M132), K136 (≠ G134)
- binding iron/sulfur cluster: W24 (≠ F22), C25 (= C23), C28 (= C26), C59 (= C57), C208 (= C206), T210 (= T208), F211 (≠ Q209)
- binding thiamine diphosphate: I57 (= I55), G58 (= G56), C59 (= C57), S60 (= S58), H76 (= H74), G102 (= G100), D103 (= D101), N129 (= N127), I131 (= I129), G133 (= G131), L134 (≠ M132), T135 (= T133)
6n2oB 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
34% identity, 95% coverage: 14:275/277 of query aligns to 16:277/291 of 6n2oB
- binding 2-oxoglutaric acid: R62 (= R60), L134 (≠ M132)
- binding coenzyme a: K136 (≠ G134), Y150 (≠ M148)
- binding magnesium ion: D101 (= D99), N129 (= N127), I131 (= I129)
- binding iron/sulfur cluster: W24 (≠ F22), C25 (= C23), C28 (= C26), C59 (= C57), C208 (= C206), T210 (= T208), F211 (≠ Q209)
- binding thiamine diphosphate: I57 (= I55), G58 (= G56), C59 (= C57), S60 (= S58), H76 (= H74), G102 (= G100), D103 (= D101), N129 (= N127), I131 (= I129), Y132 (= Y130), G133 (= G131), L134 (≠ M132), T135 (= T133)
6n2nB Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
34% identity, 95% coverage: 14:275/277 of query aligns to 16:277/291 of 6n2nB
- binding magnesium ion: D101 (= D99), N129 (= N127), I131 (= I129)
- binding iron/sulfur cluster: W24 (≠ F22), C25 (= C23), C28 (= C26), H30 (= H28), C59 (= C57), C208 (= C206), T210 (= T208), F211 (≠ Q209)
- binding thiamine diphosphate: I57 (= I55), G58 (= G56), C59 (= C57), S60 (= S58), H76 (= H74), G100 (= G98), D101 (= D99), G102 (= G100), D103 (= D101), N129 (= N127), I131 (= I129), Y132 (= Y130), G133 (= G131), L134 (≠ M132), T135 (= T133)
Q96Y68 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 2 papers)
35% identity, 88% coverage: 22:264/277 of query aligns to 11:267/305 of Q96Y68
- C12 (= C23) binding
- C15 (= C26) binding
- C46 (= C57) binding
- K49 (≠ R60) mutation to I: Loss of oxidoreductase activity toward 2-oxoglutarate but retains its activity toward pyruvate.
- D90 (= D99) binding
- GD 91:92 (= GD 100:101) binding
- N118 (= N127) binding
- V120 (≠ I129) binding
- GL 122:123 (≠ GM 131:132) binding
- K125 (≠ G134) Plays an important role in the binding of CoA; mutation to A: Shows a strong decrease of affinity for CoA and a poor inactivation by 4-fluoro-7-nitrobenzofurazan (NBD-F).
- K173 (≠ I182) mutation to A: Same oxidoreductase activity as the wild-type.
- C197 (= C206) binding
P72579 2-oxoacid:ferredoxin oxidoreductase subunit beta; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see paper)
35% identity, 88% coverage: 22:264/277 of query aligns to 11:267/305 of P72579
- K49 (≠ R60) mutation to I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to R: Increase the oxidoreductase activity with pyruvate.; mutation to V: Slight decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.
- L123 (≠ M132) mutation L->A,I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to N: Strong decrease of the oxidoreductase activity with pyruvate and 2-oxobutyrate. However, this mutant shows almost the same activity with 2-oxoglutarate as the wild-type.
5b47B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
35% identity, 88% coverage: 22:264/277 of query aligns to 4:238/275 of 5b47B
- binding magnesium ion: D83 (= D99), N111 (= N127)
- binding iron/sulfur cluster: C5 (= C23), C8 (= C26), C39 (= C57), C179 (= C206)
- binding thiamine diphosphate: I37 (= I55), G38 (= G56), C39 (= C57), S40 (= S58), H58 (= H74), G84 (= G100), D85 (= D101), N111 (= N127), V113 (≠ I129), Y114 (= Y130), L116 (≠ M132)
5b48B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
35% identity, 88% coverage: 22:264/277 of query aligns to 7:249/286 of 5b48B
- binding magnesium ion: D84 (= D99), N112 (= N127), V114 (≠ I129)
- binding iron/sulfur cluster: C8 (= C23), C11 (= C26), C42 (= C57), C183 (= C206), T185 (= T208)
- binding 2-[(2E)-3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-(1-oxidanylpropylidene)-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: I40 (= I55), G41 (= G56), C42 (= C57), S43 (= S58), H59 (= H74), G85 (= G100), D86 (= D101), N112 (= N127), V114 (≠ I129), Y115 (= Y130), G116 (= G131), L117 (≠ M132)
P94692 Pyruvate:ferredoxin oxidoreductase; PFOR; POR; Pyruvate synthase; EC 1.2.7.1 from Desulfocurvibacter africanus (Desulfovibrio africanus) (see 3 papers)
29% identity, 68% coverage: 90:277/277 of query aligns to 954:1133/1232 of P94692
Sites not aligning to the query:
- 31 binding
- 64 binding
- 114 binding
- 689 binding
- 692 binding
- 695 binding
- 699 binding
- 745 binding
- 748 binding
- 751 binding
- 755 binding
- 812 binding
- 815 binding
- 817 binding
- 840 binding ; binding
2c3uA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form (see paper)
29% identity, 68% coverage: 90:277/277 of query aligns to 953:1132/1231 of 2c3uA
- active site: N995 (≠ M132)
- binding 2-(3-{[4-(hydroxyamino)-2-methylpyrimidin-5-yl]methyl}-4-methyl-2,3-dihydro-1,3-thiazol-5-yl)ethyl trihydrogen diphosphate: G961 (= G98), D962 (= D99), G963 (= G100), W964 (≠ D101), V992 (≠ I129), Y993 (= Y130), S994 (≠ G131), N995 (≠ M132), T996 (= T133)
- binding calcium ion: D982 (≠ G119), N984 (≠ T121), A1055 (= A191), E1056 (≠ I192), F1058 (≠ H194), G1060 (= G196), S1062 (= S198)
- binding magnesium ion: D962 (= D99), T990 (≠ N127), V992 (≠ I129)
- binding pyruvic acid: N995 (≠ M132)
- binding iron/sulfur cluster: C1070 (= C206), I1071 (≠ P207)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding 2-(3-{[4-(hydroxyamino)-2-methylpyrimidin-5-yl]methyl}-4-methyl-2,3-dihydro-1,3-thiazol-5-yl)ethyl trihydrogen diphosphate: 28, 29, 63, 87, 816, 837, 839, 868, 869
- binding pyruvic acid: 30, 113, 122
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 691, 692, 694, 698, 699, 702, 703, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 811, 814, 816, 839
2c3pA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
29% identity, 68% coverage: 90:277/277 of query aligns to 953:1132/1231 of 2c3pA
- active site: N995 (≠ M132)
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: G961 (= G98), D962 (= D99), G963 (= G100), V992 (≠ I129), Y993 (= Y130), S994 (≠ G131), N995 (≠ M132), T996 (= T133)
- binding calcium ion: D982 (≠ G119), V983 (= V120), N984 (≠ T121), A1055 (= A191), E1056 (≠ I192), F1058 (≠ H194), G1060 (= G196), S1062 (= S198)
- binding magnesium ion: D962 (= D99), T990 (≠ N127), V992 (≠ I129)
- binding iron/sulfur cluster: S994 (≠ G131), C1070 (= C206), I1071 (≠ P207)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding 1-(2-{(2s,4r,5r)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1s)-1-carboxy-1-hydroxyethyl]-4-methyl-1,3-thiazolidin-5-yl}ethoxy)-1,1,3,3-tetrahydroxy-1lambda~5~-diphosphox-1-en-2-ium 3-oxide: 28, 29, 30, 63, 87, 113, 816, 837, 838, 839, 868, 869
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 702, 703, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 810, 811, 814, 816, 839
2c3oA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
29% identity, 68% coverage: 90:277/277 of query aligns to 953:1132/1231 of 2c3oA
- active site: N995 (≠ M132)
- binding calcium ion: D982 (≠ G119), N984 (≠ T121), E1056 (≠ I192), F1058 (≠ H194), G1060 (= G196)
- binding magnesium ion: D962 (= D99), T990 (≠ N127), V992 (≠ I129)
- binding pyruvic acid: T996 (= T133)
- binding iron/sulfur cluster: C1070 (= C206), I1071 (≠ P207)
- binding thiamine diphosphate: G961 (= G98), D962 (= D99), G963 (= G100), V992 (≠ I129), Y993 (= Y130), S994 (≠ G131), N995 (≠ M132), T996 (= T133)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding pyruvic acid: 30, 113
- binding iron/sulfur cluster: 458, 681, 688, 689, 691, 692, 694, 698, 699, 702, 703, 744, 746, 747, 748, 749, 750, 754, 760, 761, 810, 811, 814, 816, 839
- binding thiamine diphosphate: 28, 29, 63, 87, 816, 837, 838, 839, 868
1kekA Crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase (see paper)
29% identity, 68% coverage: 90:277/277 of query aligns to 953:1132/1231 of 1kekA
- active site: N995 (≠ M132)
- binding calcium ion: D982 (≠ G119), N984 (≠ T121), A1055 (= A191), E1056 (≠ I192), F1058 (≠ H194), S1062 (= S198)
- binding 2-acetyl-thiamine diphosphate: G961 (= G98), D962 (= D99), G963 (= G100), V992 (≠ I129), Y993 (= Y130), S994 (≠ G131), N995 (≠ M132), T996 (= T133)
- binding magnesium ion: D962 (= D99), T990 (≠ N127), V992 (≠ I129)
- binding iron/sulfur cluster: C1070 (= C206), I1071 (≠ P207)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding 2-acetyl-thiamine diphosphate: 29, 63, 87, 113, 816, 837, 838, 839, 868
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 703, 737, 744, 745, 746, 747, 748, 750, 754, 755, 760, 761, 810, 811, 814, 816, 839
1b0pA Crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus (see paper)
29% identity, 68% coverage: 90:277/277 of query aligns to 953:1132/1231 of 1b0pA
- active site: N995 (≠ M132)
- binding calcium ion: D982 (≠ G119), N984 (≠ T121), A1055 (= A191), E1056 (≠ I192), F1058 (≠ H194), G1060 (= G196)
- binding magnesium ion: D962 (= D99), T990 (≠ N127), V992 (≠ I129)
- binding iron/sulfur cluster: S994 (≠ G131), C1070 (= C206), I1071 (≠ P207)
- binding thiamine diphosphate: G961 (= G98), D962 (= D99), G963 (= G100), V992 (≠ I129), Y993 (= Y130), S994 (≠ G131), N995 (≠ M132), T996 (= T133)
Sites not aligning to the query:
- active site: 30, 63, 113
- binding iron/sulfur cluster: 458, 681, 683, 688, 689, 690, 691, 692, 694, 698, 699, 702, 703, 737, 744, 745, 747, 748, 750, 754, 755, 760, 811, 814, 816, 839
- binding thiamine diphosphate: 28, 29, 63, 816, 837, 838, 839, 868
7plmA Cryoem reconstruction of pyruvate ferredoxin oxidoreductase (pfor) in anaerobic conditions (see paper)
31% identity, 45% coverage: 90:213/277 of query aligns to 921:1045/1177 of 7plmA
- binding calcium ion: D950 (≠ G119), N952 (≠ T121), F1026 (≠ H194), G1028 (= G196)
- binding magnesium ion: D930 (= D99), T958 (≠ N127), V960 (≠ I129), S962 (≠ G131)
- binding iron/sulfur cluster: S962 (≠ G131), C1038 (= C206), I1039 (≠ P207)
- binding thiamine diphosphate: G929 (= G98), D930 (= D99), G931 (= G100), V960 (≠ I129), Y961 (= Y130), S962 (≠ G131), N963 (≠ M132), T964 (= T133)
Sites not aligning to the query:
- binding iron/sulfur cluster: 458, 657, 659, 664, 665, 666, 667, 668, 670, 674, 675, 679, 708, 715, 716, 717, 718, 719, 721, 725, 726, 731, 732, 781, 782, 785, 787, 810
- binding thiamine diphosphate: 27, 28, 29, 63, 787, 808, 809, 810, 839
6cipA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with acetyl-tpp bound (see paper)
29% identity, 66% coverage: 90:271/277 of query aligns to 957:1141/1165 of 6cipA
Sites not aligning to the query:
- active site: 28, 61, 111
- binding 2-acetyl-thiamine diphosphate: 27, 61, 85, 111, 813, 834, 835, 836, 865
- binding iron/sulfur cluster: 455, 678, 680, 685, 686, 688, 689, 691, 695, 699, 700, 734, 741, 742, 744, 745, 747, 751, 757, 758, 807, 808, 811, 813, 836
Q2RMD6 Pyruvate:ferredoxin oxidoreductase; PFOR; Pyruvate synthase; EC 1.2.7.1 from Moorella thermoacetica (strain ATCC 39073 / JCM 9320) (see paper)
28% identity, 66% coverage: 90:272/277 of query aligns to 958:1143/1171 of Q2RMD6
Sites not aligning to the query:
- 424:428 binding
- 456 binding
- 556 binding
- 598 binding
- 686 binding
- 689 binding
- 692 binding
- 696 binding
- 742 binding
- 745 binding
- 748 binding
- 752 binding
- 809 binding
- 812 binding
- 814 binding
- 837 binding ; binding
6ciqA Pyruvate:ferredoxin oxidoreductase from moorella thermoacetica with coenzyme a bound (see paper)
28% identity, 66% coverage: 90:272/277 of query aligns to 957:1142/1169 of 6ciqA
- active site: N999 (≠ M132)
- binding coenzyme a: N999 (≠ M132)
- binding magnesium ion: D966 (= D99), T994 (≠ N127), V996 (≠ I129)
- binding iron/sulfur cluster: S998 (≠ G131), C1074 (= C206), I1075 (≠ P207)
- binding thiamine diphosphate: G965 (= G98), D966 (= D99), G967 (= G100), V996 (≠ I129), Y997 (= Y130), S998 (≠ G131), N999 (≠ M132), T1000 (= T133)
Sites not aligning to the query:
- active site: 28, 61, 111
- binding coenzyme a: 28, 423, 424, 427, 428, 553, 586
- binding iron/sulfur cluster: 678, 680, 685, 686, 688, 689, 691, 695, 696, 700, 734, 741, 742, 743, 744, 745, 747, 751, 757, 807, 808, 811, 813, 836
- binding thiamine diphosphate: 26, 27, 61, 85, 813, 835, 836, 865
6cinB Crystal structure of pyruvate:ferredoxin oxidoreductase from moorella thermoacetica (see paper)
28% identity, 66% coverage: 90:272/277 of query aligns to 957:1142/1169 of 6cinB
- active site: N999 (≠ M132)
- binding magnesium ion: D966 (= D99), T994 (≠ N127), V996 (≠ I129)
- binding iron/sulfur cluster: S998 (≠ G131), C1074 (= C206), I1075 (≠ P207)
- binding thiamine diphosphate: G965 (= G98), D966 (= D99), G967 (= G100), V996 (≠ I129), Y997 (= Y130), S998 (≠ G131), N999 (≠ M132), T1000 (= T133)
Sites not aligning to the query:
- active site: 28, 61, 111
- binding iron/sulfur cluster: 455, 678, 685, 686, 687, 688, 689, 691, 695, 700, 741, 742, 743, 744, 745, 746, 747, 751, 752, 757, 758, 807, 808, 811, 813, 836
- binding thiamine diphosphate: 26, 27, 61, 834, 835, 836, 865
Query Sequence
>8499839 FitnessBrowser__Miya:8499839
MADVTQLIHDYLRHNKKFPHVFCAGCGHGIVLGSLIRSVHALGLPKDDVVLVAGIGCSGR
MAVYVDFNTVHTTHGRALTFATGIKMANPKLKVICVMGDGDALSIGGNHLIHAARRNIGV
TALILNNQIYGMTGGQCSSATPQGDISMTTPFGSLEKAFDIADMCKAAGASYVARGTSFH
AIQLDRLISSAIMHPGFSVVEVFSPCPTQYGRKNKFRNAVDMYKWLKSNTVKVETLKDPD
QKPADGRIPIGVFRDVEEPGLEERYFELQRKLMGQNR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory