Comparing 8499847 FitnessBrowser__Miya:8499847 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
39% identity, 93% coverage: 24:430/436 of query aligns to 2:406/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
39% identity, 93% coverage: 24:430/436 of query aligns to 2:406/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
34% identity, 95% coverage: 17:429/436 of query aligns to 1:408/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 70% coverage: 133:436/436 of query aligns to 109:451/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 70% coverage: 133:436/436 of query aligns to 108:450/455 of 5j7iC
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
28% identity, 60% coverage: 124:386/436 of query aligns to 127:433/476 of 4yweA
Sites not aligning to the query:
>8499847 FitnessBrowser__Miya:8499847
MSTQNTTTPDATRDTSTSDIVQLVESMGKRAKAAARKLAAASPAAKIDALVRLAGLLESR
EADILAANARDLAAAEAAGMDTPRMDRLRLTPRIMAEMAAACRHVAGLPDPVGAVETQWQ
RPNGLLVGRMRIPLGVIAIIYESRPNVTIDSAILCLKAGNAVILRGGSEAIHSNLALAGL
IAEAMSASGLPDDAVQVVSRTDRAAVGALCALEQYIDVIIPRGGETLIRAVVQQATMPVL
KHYKGVCHAYVDAGADLDQAVEIVFNGKVQRPGVCNALECLLVHKDEAAALLPAVAARLA
PAGVTFRACPTALPLLGDAATAAAPEDYGMEFHDLILAVRVVDDMDEALAHIAAHGSNHT
EIICTRDHGRAMRFLREADASMVAVNASTRFNDGGQLGLGAEIGISTSKLHSYGPMGVQE
LTTTKFVVFGAGQVRE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory