SitesBLAST
Comparing 8499876 FitnessBrowser__Miya:8499876 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
73% identity, 100% coverage: 1:902/905 of query aligns to 1:905/906 of 1dgjA
- active site: V391 (≠ I390), F427 (= F425), R503 (= R501), Y507 (≠ F505), R535 (= R533), E869 (= E866), M870 (≠ L867)
- binding molybdenum (iv)oxide: G424 (= G422), R535 (= R533), G698 (= G696), E869 (= E866)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), G39 (= G39), C40 (= C40), G41 (= G41), G43 (= G43), Q44 (= Q44), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding pterin cytosine dinucleotide: Q99 (= Q99), C139 (= C139), F423 (= F421), G424 (= G422), R535 (= R533), W652 (= W650), H655 (= H653), G656 (= G654), Q657 (= Q655), G658 (= G656), A697 (= A695), G698 (= G696), S700 (= S698), S702 (= S700), Q703 (= Q701), C799 (≠ N796), N800 (= N797), V803 (≠ L800), V804 (= V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of 4usaA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E866), L870 (= L867)
- binding bicarbonate ion: R460 (= R460), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (≠ E539)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding hydrocinnamic acid: I255 (= I255), F425 (= F425), F494 (= F494), L497 (= L497), Y535 (= Y535), L626 (= L626)
- binding magnesium ion: E899 (= E896), E903 (≠ A900)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N796), N800 (= N797), T804 (≠ V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of 4us9A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E866), L870 (= L867)
- binding 3-phenylpropanal: I255 (= I255), F257 (= F257), P258 (= P258), H752 (= H750)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (≠ E539), R890 (= R887), Y892 (≠ R889)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E896), E903 (≠ A900)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N796), N800 (= N797), T804 (≠ V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of 4us8A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E866), L870 (= L867)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (≠ E539)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding benzaldehyde: I255 (= I255), I255 (= I255), L394 (= L394), F425 (= F425), F425 (= F425), F425 (= F425), F425 (= F425), L497 (= L497), L497 (= L497), R501 (= R501), A531 (= A531), Y535 (= Y535), Y535 (= Y535), L626 (= L626), L626 (= L626), L626 (= L626), P694 (= P694), G696 (= G696), G697 (= G697)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N796), N800 (= N797), T804 (≠ V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of 4c7yA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E866), L870 (= L867)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), Y535 (= Y535), Q539 (≠ E539)
- binding fe2/s2 (inorganic) cluster: C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E896), E903 (≠ A900)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N796), N800 (= N797), T804 (≠ V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
- binding hydrogen peroxide: G696 (= G696), G697 (= G697), E869 (= E866)
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of 3fc4A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E866), L870 (= L867)
- binding 1,2-ethanediol: Y535 (= Y535), Y622 (= Y622), G696 (= G696), G697 (= G697), E869 (= E866)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E896), E903 (≠ A900)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), G419 (= G419), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N796), N800 (= N797), T804 (≠ V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of 3fahA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E866), L870 (= L867)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding glycerol: P416 (= P416), Y535 (= Y535), Y622 (= Y622), W683 (≠ L683), G696 (= G696), G697 (= G697), E869 (= E866), K884 (≠ Y881), V889 (= V886), R890 (= R887), Y892 (≠ R889)
- binding magnesium ion: E899 (= E896), E903 (≠ A900)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), G419 (= G419), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N796), N800 (= N797), T804 (≠ V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of 1sijA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E866), L870 (= L867)
- binding arsenite: Y535 (= Y535), G696 (= G696), G697 (= G697), E869 (= E866)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), Q99 (= Q99), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E896), E903 (≠ A900)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), S698 (= S698), Q700 (≠ S700), Q701 (= Q701), C799 (≠ N796), N800 (= N797), T804 (≠ V801), Q807 (= Q804), S865 (= S862), G866 (= G863), V867 (= V864), G868 (= G865), E869 (= E866)
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
73% identity, 100% coverage: 1:903/905 of query aligns to 1:906/907 of Q46509
- C40 (= C40) binding
- C45 (= C45) binding
- C48 (= C48) binding
- C60 (= C60) binding
- C100 (= C100) binding
- C103 (= C103) binding
- C137 (= C137) binding
- C139 (= C139) binding
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
28% identity, 80% coverage: 177:898/905 of query aligns to 549:1280/1307 of 2e1qA
- active site: Q742 (≠ I390), V777 (≠ F425), R855 (= R501), H859 (≠ F505), R887 (= R533), G1235 (= G865), E1236 (= E866)
- binding bicarbonate ion: R814 (= R460), H815 (≠ S461), I852 (≠ L498), F886 (= F532), F889 (≠ Y535), G890 (= G536), Q893 (≠ E539)
- binding calcium ion: E715 (≠ P364), H716 (= H365), Y718 (≠ P367), T741 (≠ S389), T747 (≠ H395), S780 (= S426), T781 (≠ P427), S784 (≠ E430), T811 (= T457), G812 (= G458)
- binding fe2/s2 (inorganic) cluster: L719 (≠ I368)
- binding hydroxy(dioxo)molybdenum: F773 (= F421), G774 (= G422), R887 (= R533), A1053 (≠ G696), A1054 (≠ G697), E1236 (= E866)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
2ckjA Human milk xanthine oxidoreductase
28% identity, 80% coverage: 177:898/905 of query aligns to 518:1249/1264 of 2ckjA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
28% identity, 80% coverage: 177:898/905 of query aligns to 575:1306/1333 of P47989
- D584 (≠ I186) to A: in dbSNP:rs45491693
- R607 (≠ A211) to Q: in dbSNP:rs45442092
- K617 (= K221) to N: in dbSNP:rs45442398
- T623 (= T227) to I: in dbSNP:rs45448694
- I646 (= I251) to V: in dbSNP:rs17323225
- I703 (≠ M317) to V: in dbSNP:rs17011368
- L763 (≠ I385) to F: in a breast cancer sample; somatic mutation
- R791 (≠ V413) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- T910 (≠ S530) to M: in dbSNP:rs669884
- C993 (≠ T608) modified: Disulfide link with 536, In oxidase form
- V1091 (= V708) to L: in dbSNP:rs45619033
- N1109 (≠ K721) to T: in dbSNP:rs45547640
- P1150 (= P759) to R: in dbSNP:rs1042036
- R1176 (≠ K785) to C: in dbSNP:rs45624433
- R1296 (vs. gap) to W: in dbSNP:rs45564939
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 1318 modified: Disulfide link with 509, In oxidase form
3b9jC Structure of xanthine oxidase with 2-hydroxy-6-methylpurine (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 4:735/758 of 3b9jC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G865), E691 (= E866)
- binding 6-methyl-3,9-dihydro-2H-purin-2-one: E232 (vs. gap), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), A509 (≠ G697), E691 (= E866)
- binding calcium ion: R269 (= R460), H270 (≠ S461)
3nvzC Crystal structure of bovine xanthine oxidase in complex with indole-3- aldehyde (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 4:735/755 of 3nvzC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G865), E691 (= E866)
- binding 1h-indole-3-carbaldehyde: E232 (vs. gap), L303 (≠ F494), S306 (≠ L497), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), V441 (≠ G628), L444 (≠ T631)
3nvvC Crystal structure of bovine xanthine oxidase in complex with arsenite (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 4:735/755 of 3nvvC
3ns1C Crystal structure of bovine xanthine oxidase in complex with 6- mercaptopurine (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 4:735/755 of 3ns1C
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G865), E691 (= E866)
- binding 9H-purine-6-thiol: E232 (vs. gap), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627)
3etrC Crystal structure of xanthine oxidase in complex with lumazine (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 4:735/755 of 3etrC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G865), E691 (= E866)
- binding calcium ion: R269 (= R460), H270 (≠ S461), I307 (≠ L498)
- binding pteridine-2,4(1H,3H)-dione: L303 (≠ F494), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), V441 (≠ G628), L444 (≠ T631), A509 (≠ G697)
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 540:1271/1298 of 1v97A
- active site: Q733 (≠ I390), E768 (vs. gap), R846 (= R501), H850 (≠ F505), R878 (= R533), G1226 (= G865), E1227 (= E866)
- binding calcium ion: A833 (≠ H488), S836 (≠ Y491), R837 (≠ S492), S840 (≠ G495), S873 (≠ W528), N874 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L710 (≠ I368)
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: E768 (vs. gap), L839 (≠ F494), R846 (= R501), F880 (≠ Y535), F975 (≠ L626), L980 (≠ T631), P1042 (= P694), A1044 (≠ G696), A1045 (≠ G697), E1227 (= E866)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 541:1272/1299 of 1vdvA
- active site: Q734 (≠ I390), E769 (vs. gap), R847 (= R501), H851 (≠ F505), R879 (= R533), G1227 (= G865), E1228 (= E866)
- binding calcium ion: H708 (= H365), Y710 (≠ P367), T803 (= T457), G804 (= G458), A834 (≠ H488), S837 (≠ Y491), R838 (≠ S492), S841 (≠ G495), S874 (≠ W528), N875 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L711 (≠ I368)
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: E769 (vs. gap), L840 (≠ F494), S843 (≠ L497), R847 (= R501), F881 (≠ Y535), F976 (≠ L626), T977 (≠ D627), V978 (≠ G628), L981 (≠ T631), P1043 (= P694), A1046 (≠ G697)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
1fo4A Crystal structure of xanthine dehydrogenase isolated from bovine milk (see paper)
27% identity, 80% coverage: 177:898/905 of query aligns to 541:1272/1299 of 1fo4A
- active site: Q734 (≠ I390), E769 (vs. gap), R847 (= R501), H851 (≠ F505), R879 (= R533), G1227 (= G865), E1228 (= E866)
- binding calcium ion: A834 (≠ H488), S837 (≠ Y491), R838 (≠ S492), S841 (≠ G495), S874 (≠ W528), N875 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L711 (≠ I368)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 147, 148
Query Sequence
>8499876 FitnessBrowser__Miya:8499876
MINKHFIVNGIPRNLVVDPEATLADVLREQLLLTGVKVGCGEGQCGACSVILDGKVVRSC
AYKMRRLPDGASVTTIEGVGSPDCLHPLQLAWTAHGGAQCGFCTPGFIVSARQLLEENKS
PSRDDVRDWFQKHRNVCRCTGYKPLVDAVMDAAKVLRGEMSADDLCFKIPADGRIWGSKY
PRPSAIAKVTGTCDYGADLGLKLPSDALHLALVQAEVSHAKILSIDTSEAMKMPGVHSVL
THKDVKGKNRITGLITFPSNKGDGWDRPILCDEKVFQYGDALAIVCADSEKHARAAAEKV
KVQLEELPAYMSAPAAMAEDAMEIHPGTPNVYFIQNIAKGADTRPIFDGADVVVEGDYYV
GRQPHLPIEPDVGFAYTDGEGRLVIHSKSIGLHLHLYMIAPGLGLEPEKIVMVQNPAGGT
FGYKFSPTMEALVGVAAMATGRPVHLRYNYRQQQNYTGKRSPFFFNVRYAADKTGKIKAM
ETDWTVDHGPYSEFGDLLTLRGAQFAGAGYGIANIRGQGRTVCTNHAWGSAFRGYGAPES
EFPSEVLMDELAEKLGMDPLELRYLNVYRKGDTNPTGQDPEVYSLPEMIDILRPKYKAAL
DAARAGSTAAVKKGVGVAVGVYGCGLDGPDTSECDAELNPDGTVTIYNCWEDHGQGADMG
TLGTAHEALRPLGIAPQNIRLVLNDTSKAPNSGPAGGSRSQYVTGNAVRVACENLVEAMR
KPGGFRTYQEMVDEKIATKHRGAWTAAGTHCDENAQGKPFTAYMYGVFMAEVAVEVATGK
TTVDKLTMVADIGKINNKLLVDGQLYGGLAQGIGLALSEDYEDLKKHATMAGAGVPYIKD
IPDNIELIYVETPRGDGPFGASGVGELPLTVPHAAIINGIYKACGVRIRHLPALPEKVLA
GLKGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory