Comparing 8499887 FitnessBrowser__Miya:8499887 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
42% identity, 92% coverage: 21:362/370 of query aligns to 7:365/369 of 3h7cX
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
40% identity, 92% coverage: 21:362/370 of query aligns to 7:372/374 of G7JT50
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
41% identity, 91% coverage: 26:362/370 of query aligns to 2:358/360 of 6nicD
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 92% coverage: 21:362/370 of query aligns to 7:372/383 of Q8GWW7
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
36% identity, 94% coverage: 16:362/370 of query aligns to 4:363/365 of Q837U5
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
23% identity, 90% coverage: 32:364/370 of query aligns to 15:331/333 of 6b2wA
>8499887 FitnessBrowser__Miya:8499887
MERTSPPLPPNFAPVRLPVRAPVCDGLHMPAEWSPHAGCWMAWPCPDPLLEDALDTVRTS
FAGVVRAIARFEPVTLLARPEDAEVAAALCGPGVQVVPAPITDAWMRDFGPTFVVDGAGG
VAGVDWMFNSWGHTYDEPTHDDDVAQLILSRLGMRRYAAPFILEGGSIHVDGQGTLMTTE
QCLLDPRRNAGMTKADFEELFAAYLGVRKVIWLGEGLEGDDTHGHVDIVSCFARPGVVLL
HRCDDPEDPNHAVYQDNLRRLQLATDADGKPLEIVTIDQPNRAEHGGKRMDLSYINFYVA
NGGIVMSAFGAPGGGADSQGALDRVAFETLRRVFPEREVVQVHSLDIFRGGGGIHCITQQ
QPVGRPLSPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory