SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 8499892 FitnessBrowser__Miya:8499892 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 4 hits to proteins with known functional sites (download)

P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
32% identity, 84% coverage: 24:271/297 of query aligns to 41:287/313 of P94529

query
sites
P94529
L
 
L
A
 
S
F
 
F
I
 
L
A
 
V
A
 
F
F
 
F
T
 
L
H
 
-
Y
 
Y
P
 
P
A
 
I
V
 
I
N
 
S
T
 
V
F
 
F
I
 
I
H
 
M
S
 
S
F
 
F
-
 
Q
-
 
R
F
 
I
L
 
L
D
 
P
G
 
G
R
 
E
G
 
-
G
 
-
A
 
-
P
 
-
A
 
V
Q
 
S
F
 
F
V
 
V
G
 
G
L
 
L
E
 
S
H
 
N
Y
 
Y
Q
 
T
Y
 
-
L
 
A
L
 
L
E
 
N
D
 
N
E
 
P
V
 
T
F
 
F
R
 
Y
K
 
T
A
 
A
L
 
L
V
 
W
N
 
N
N
 
T
L
 
L
L
 
E
F
 
Y
A
 
T
S
 
F
G
 
W
T
 
T
I
 
L
P
 
I
L
 
V
S
 
L
I
 
I
G
 
P
L
 
V
A
 
P
M
 
L
T
 
L
M
 
L
A
 
A
F
 
I
L
 
F
V
 
L
N
 
N
A
 
S
G
 
K
L
 
L
A
 
V
G
 
K
-
 
F
Q
 
R
S
 
N
V
 
I
L
 
F
R
 
K
L
 
S
C
 
A
Y
 
L
F
 
F
V
 
I
P
 
P
T
 
A
V
 
L
L
 
T
P
 
S
M
 
T
I
 
I
A
 
V
V
 
A
A
 
G
N
 
I
I
 
I
W
 
F
-
 
R
L
 
L
F
 
I
F
 
F
Y
 
G
T
 
E
P
 
M
E
 
E
Y
 
T
G
 
S
L
 
L
L
 
A
E
 
N
Q
 
S
I
 
I
R
 
L
G
 
L
A
 
K
L
 
L
G
 
G
L
 
F
A
 
S
G
 
P
V
 
Q
N
 
N
W
 
W
L
 
M
G
 
N
S
 
N
E
 
E
S
 
H
T
 
T
A
 
G
L
 
M
P
 
F
C
 
L
V
 
M
I
 
V
A
 
L
V
 
L
A
 
A
V
 
S
W
 
W
K
 
R
D
 
W
A
 
M
G
 
G
F
 
I
F
 
N
M
 
I
I
 
L
F
 
Y
Y
 
F
L
 
L
A
 
A
A
 
G
L
 
L
Q
 
Q
Q
 
N
I
 
V
P
 
P
P
 
K
S
x
E
L
 
L
G
 
Y
E
|
E
A
 
A
A
 
A
M
 
D
L
 
I
E
x
D
G
 
G
A
 
A
S
 
N
R
 
T
L
 
M
Y
 
K
Y
 
K
Y
 
F
R
 
L
R
 
H
V
 
I
V
 
T
I
 
L
P
 
P
L
 
F
L
 
L
M
 
K
P
 
P
T
 
V
T
 
T
L
 
V
F
 
Y
V
 
V
L
 
L
V
 
T
N
 
I
A
 
S
T
 
I
I
 
I
N
 
G
A
 
G
F
 
F
R
 
R
M
 
M
V
 
F
D
 
E
H
 
E
L
 
S
F
 
Y
V
 
V
L
 
L
T
 
W
Q
 
Q
G
 
N
G
 
N
-
 
S
P
 
P
N
 
G
N
 
N
A
 
I
S
 
G
S
 
L
L
 
T
L
 
L
L
 
V
Y
 
G
Y
 
Y
I
 
L
Y
 
Y
E
 
Q
V
 
Q
S
 
G
F
 
L
K
 
A
Y
 
Y
W
 
N
D
 
E
T
 
M
G
 
G
Y
 
Y
G
 
G
A
 
A
A
 
A
L
 
I

7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
26% identity, 94% coverage: 7:284/297 of query aligns to 2:271/285 of 7cagA

query
sites
7cagA
S
 
D
H
 
K
A
 
K
T
 
S
M
 
E
R
 
R
T
 
R
I
 
L
H
 
A
A
 
F
W
 
W
L
 
L
L
 
I
L
 
A
L
 
-
P
 
P
A
 
A
L
 
V
A
 
L
F
 
L
I
 
M
A
 
L
A
 
A
F
 
V
T
 
T
H
 
A
Y
 
Y
P
 
P
-
 
I
-
 
G
-
 
Y
A
 
A
V
 
V
N
 
W
T
 
L
F
 
S
I
 
L
H
 
Q
S
 
R
F
 
Y
F
 
N
L
 
L
D
 
A
G
 
E
R
 
P
G
 
H
G
 
D
A
 
T
P
 
-
A
 
-
Q
 
E
F
 
F
V
 
I
G
 
G
L
 
L
E
 
A
H
 
N
Y
 
Y
Q
 
V
Y
 
T
L
 
V
L
 
L
E
 
T
D
 
D
E
 
G
V
 
Y
F
 
W
R
 
W
K
 
T
A
 
A
L
 
F
V
 
A
N
 
V
N
 
T
L
 
L
L
 
G
F
 
I
A
 
T
S
 
V
G
 
V
T
 
S
I
 
V
P
 
A
L
 
I
S
 
E
I
 
F
G
 
A
L
 
L
A
 
G
M
 
L
T
 
A
M
 
L
A
 
A
F
 
L
L
 
V
V
 
M
N
 
H
A
 
R
G
 
T
L
 
I
A
 
F
G
 
G
Q
 
K
S
 
G
V
 
A
L
 
V
R
 
R
L
 
T
C
 
A
Y
 
I
F
 
L
V
 
I
P
 
P
T
 
Y
V
 
G
L
 
I
P
 
V
M
 
T
I
 
V
A
 
A
V
 
A
A
 
S
N
 
Y
I
 
S
W
 
W
L
 
Y
F
 
Y
F
 
A
Y
 
W
T
 
T
P
 
P
E
 
G
Y
 
T
G
 
G
L
 
Y
L
 
L
E
 
A
Q
 
N
I
 
L
R
 
L
G
 
P
A
 
E
L
 
-
G
 
-
L
 
-
A
 
-
G
 
G
V
 
S
N
 
A
W
 
P
L
 
L
G
 
T
S
 
D
E
 
Q
S
 
L
T
 
P
A
 
S
L
 
L
P
 
A
C
 
I
V
 
V
I
 
V
A
 
L
V
 
A
A
x
E
V
 
V
W
 
W
K
|
K
D
 
T
A
 
T
G
 
P
F
 
F
F
 
M
M
 
A
I
 
L
F
 
L
Y
 
L
L
 
L
A
 
A
A
 
G
L
 
L
Q
 
A
Q
 
L
I
 
V
P
 
P
P
 
Q
S
 
D
L
 
L
G
 
L
E
 
N
A
 
A
A
 
A
M
 
Q
L
 
V
E
 
D
G
 
G
A
 
A
S
 
G
R
 
P
L
 
W
Y
 
K
Y
 
R
Y
 
L
R
 
T
R
 
K
V
 
V
V
 
I
I
 
L
P
 
P
L
 
M
L
 
I
M
 
K
P
 
P
T
 
A
T
 
I
L
 
L
F
 
V
V
 
A
L
 
L
V
 
L
N
 
F
A
x
R
T
 
T
I
 
L
N
x
D
A
 
A
F
 
F
R
|
R
M
 
I
V
 
F
D
 
D
H
 
N
L
 
I
F
 
Y
V
 
I
L
 
L
T
 
T
Q
 
-
G
 
G
G
 
G
P
 
S
N
 
N
N
 
D
A
 
T
S
 
G
S
 
S
L
 
V
L
 
S
L
 
I
Y
 
L
Y
 
G
I
 
-
Y
 
Y
E
 
D
V
 
N
S
 
L
F
 
F
K
 
K
Y
 
A
W
 
F
D
 
N
T
 
V
G
 
G
Y
 
L
G
 
G
A
 
S
A
 
A
L
 
I
T
 
S
M
 
V
V
 
L
L
 
I
L
 
-
G
 
-
F
 
F
L
 
L
A
 
S
L
 
V
A
 
A
S
 
I
I
 
I

P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
26% identity, 83% coverage: 39:284/297 of query aligns to 236:506/514 of P02916

query
sites
P02916
F
 
F
I
 
Y
H
 
Q
S
 
S
F
 
I
F
 
T
L
 
A
D
 
D
G
 
G
R
 
N
G
 
W
G
 
G
-
 
D
-
 
E
-
 
K
-
 
L
A
 
S
P
 
P
A
 
G
Q
 
Y
F
 
T
V
 
V
-
 
T
-
 
T
G
 
G
L
 
W
E
 
K
H
 
N
Y
 
F
Q
 
T
Y
 
R
L
 
V
L
 
F
E
 
T
D
 
D
E
 
E
V
 
G
F
 
I
R
 
Q
K
 
K
A
 
P
L
 
F
-
 
L
-
 
A
-
 
I
-
 
F
V
 
V
N
 
W
N
 
T
L
 
V
L
 
V
F
 
F
A
 
S
S
 
L
G
 
I
T
 
T
I
 
V
P
 
F
L
 
L
S
 
T
I
 
V
G
 
A
L
 
V
A
 
G
M
 
M
T
 
V
M
 
L
A
 
A
F
 
C
L
 
L
V
 
V
N
 
Q
-
 
W
A
 
E
G
 
A
L
 
L
A
 
R
G
 
G
Q
 
K
S
 
A
V
 
V
L
 
Y
R
 
R
L
 
V
C
 
L
Y
 
L
F
 
I
V
 
L
P
 
P
T
 
Y
V
 
A
L
 
V
P
 
P
M
 
S
I
 
F
A
 
I
V
 
S
A
 
I
N
x
L
I
 
I
W
 
F
L
 
K
F
 
G
F
 
L
Y
 
F
T
 
N
P
 
Q
E
 
S
Y
 
F
G
 
G
L
 
E
L
 
I
E
 
N
Q
 
M
I
 
M
R
 
L
G
 
S
A
 
A
L
 
L
G
 
F
L
 
G
A
 
V
G
 
K
V
 
P
N
 
A
W
 
W
L
 
F
G
 
S
S
 
D
E
 
P
S
 
T
T
 
T
A
 
A
L
 
R
P
 
T
C
 
M
V
x
L
I
 
I
A
 
I
V
 
V
A
x
N
V
 
T
W
 
W
K
 
L
D
x
G
A
 
Y
G
 
P
F
 
Y
F
 
M
M
 
M
I
 
I
F
 
L
Y
 
C
L
 
M
A
 
G
A
 
L
L
 
L
Q
 
K
Q
 
A
I
 
I
P
 
P
P
 
D
S
 
D
L
 
L
G
 
Y
E
|
E
A
 
A
A
x
S
M
 
A
L
 
M
E
 
D
G
|
G
A
 
A
S
 
G
R
 
P
L
 
F
Y
 
Q
Y
 
N
Y
 
F
R
 
F
R
 
K
V
 
I
V
 
T
I
 
L
P
|
P
L
 
L
L
 
L
M
 
I
-
 
K
P
 
P
T
 
L
T
 
T
L
 
P
F
 
L
V
 
M
L
 
I
V
 
A
N
 
S
A
 
F
T
 
A
I
 
F
N
 
N
A
 
-
F
 
F
R
 
N
M
 
N
V
 
F
D
 
V
H
 
L
L
 
I
F
 
Q
V
 
L
L
 
L
T
 
T
Q
 
N
G
 
G
G
 
G
P
 
P
N
 
D
N
 
R
A
 
L
-
 
G
-
 
T
-
 
T
-
 
T
-
 
P
-
 
A
-
 
G
-
 
Y
S
 
T
S
 
D
L
 
L
L
 
L
L
 
V
Y
 
N
Y
 
Y
I
 
T
Y
 
Y
E
 
R
V
 
I
S
 
A
F
 
F
K
 
E
-
 
G
-
 
G
-
 
G
Y
 
G
W
 
Q
D
 
D
T
 
F
G
 
G
Y
 
L
G
 
A
A
 
A
A
 
A
-
 
I
-
 
A
-
 
T
L
 
L
T
 
I
M
 
F
V
 
L
L
 
L
L
 
V
G
 
G
F
 
A
L
 
L
A
 
A
L
 
I
A
 
V
S
 
N
I
 
L

4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
26% identity, 77% coverage: 56:283/297 of query aligns to 244:490/490 of 4ki0F

query
sites
4ki0F
V
 
T
G
 
G
L
 
W
E
 
K
H
 
N
Y
 
F
Q
 
T
Y
 
R
L
 
V
L
 
F
E
 
T
D
 
D
E
 
E
V
 
G
F
 
I
R
 
Q
K
 
K
A
 
P
L
 
F
-
 
L
-
 
A
-
 
I
-
 
F
V
 
V
N
 
W
N
 
T
L
 
V
L
 
V
F
 
F
A
 
S
S
 
L
G
 
I
T
|
T
I
 
V
P
 
F
L
 
L
S
 
T
I
 
V
G
 
A
L
 
V
A
 
G
M
 
M
T
 
V
M
 
L
A
 
A
F
 
C
L
 
L
V
 
V
N
 
Q
-
 
W
A
 
E
G
 
A
L
 
L
A
 
R
G
 
G
Q
 
K
S
 
A
V
 
V
L
 
Y
R
 
R
L
 
V
C
 
L
Y
 
L
F
 
I
V
 
L
P
 
P
T
x
Y
V
 
A
L
 
V
P
 
P
M
 
S
I
 
F
A
 
I
V
 
S
A
 
I
N
 
L
I
 
I
W
 
F
L
 
K
F
 
G
F
 
L
Y
 
F
T
 
N
P
 
Q
E
 
S
Y
 
F
G
 
G
L
 
E
L
 
I
E
 
N
Q
 
M
I
 
M
R
 
L
G
 
S
A
 
A
L
 
L
G
 
F
L
 
G
A
 
V
G
 
K
V
 
P
N
 
A
W
 
W
L
 
F
G
 
S
S
 
D
E
 
P
S
 
T
T
 
T
A
 
A
L
 
R
P
 
T
C
 
M
V
 
L
I
 
I
A
 
I
V
 
V
A
x
N
V
 
T
W
 
W
K
x
L
D
x
G
A
 
Y
G
 
P
F
x
Y
F
 
M
M
 
M
I
 
I
F
 
L
Y
 
C
L
 
M
A
 
G
A
 
L
L
 
L
Q
 
K
Q
 
A
I
 
I
P
 
P
P
 
D
S
 
D
L
 
L
G
 
Y
E
 
E
A
 
A
A
 
S
M
 
A
L
 
M
E
 
D
G
 
G
A
 
A
S
 
G
R
 
P
L
 
F
Y
 
Q
Y
 
N
Y
 
F
R
 
F
R
 
K
V
 
I
V
 
T
I
 
L
P
 
P
L
 
L
L
 
L
M
 
I
-
 
K
P
 
P
T
 
L
T
 
T
L
 
P
F
 
L
V
 
M
L
 
I
V
x
A
N
x
S
A
 
F
T
 
A
I
x
F
N
|
N
A
 
-
F
 
F
R
 
N
M
x
N
V
 
F
D
 
V
H
 
L
L
 
I
F
 
Q
V
 
L
L
 
L
T
 
T
Q
 
N
G
 
G
G
 
G
P
 
P
N
 
D
N
 
R
A
 
L
-
 
G
-
 
T
-
 
T
-
 
T
-
 
P
-
 
A
-
 
G
-
 
Y
S
 
T
S
 
D
L
 
L
L
 
L
L
 
V
Y
 
N
Y
 
Y
I
 
T
Y
 
Y
E
 
R
V
 
I
S
 
A
F
 
F
K
 
E
-
 
G
-
 
G
-
 
G
Y
 
G
W
 
Q
D
 
D
T
 
F
G
 
G
Y
 
L
G
 
A
A
 
A
A
 
A
-
 
I
-
 
A
-
 
T
L
 
L
T
 
I
M
 
F
V
 
L
L
 
L
L
 
V
G
 
G
F
 
A
L
 
L
A
 
A
L
 
I
A
 
V
S
 
N

Query Sequence

>8499892 FitnessBrowser__Miya:8499892
MPPAFRSHATMRTIHAWLLLLPALAFIAAFTHYPAVNTFIHSFFLDGRGGAPAQFVGLEH
YQYLLEDEVFRKALVNNLLFASGTIPLSIGLAMTMAFLVNAGLAGQSVLRLCYFVPTVLP
MIAVANIWLFFYTPEYGLLEQIRGALGLAGVNWLGSESTALPCVIAVAVWKDAGFFMIFY
LAALQQIPPSLGEAAMLEGASRLYYYRRVVIPLLMPTTLFVLVNATINAFRMVDHLFVLT
QGGPNNASSLLLYYIYEVSFKYWDTGYGAALTMVLLGFLALASIGQFGFLDRKVHYR

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory