SitesBLAST
Comparing 8500002 FitnessBrowser__Miya:8500002 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7e1sC Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
42% identity, 95% coverage: 6:358/373 of query aligns to 11:365/366 of 7e1sC
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: L104 (≠ M88), A129 (= A113), G130 (= G114), L131 (= L115), I150 (= I141), I151 (≠ V142), S152 (= S143), E178 (= E169), H185 (= H176), Y280 (≠ M277), I324 (= I317), L328 (= L321)
- binding flavin mononucleotide: G25 (= G20), G26 (= G21), M27 (= M22), G28 (= G23), N102 (= N86), E178 (= E169), S182 (≠ A173), G183 (= G174), G223 (= G219), G224 (= G220), M244 (= M240), A245 (≠ G241), T246 (= T242), L249 (≠ V245), F342 (= F335), T343 (≠ S336)
- binding iron/sulfur cluster: C303 (= C300), N306 (≠ K303), C307 (= C304), V308 (≠ I305), C311 (= C308), G314 (vs. gap), A317 (≠ Q310), C323 (= C316), I324 (= I317)
- binding : L131 (= L115), T133 (≠ L117), N134 (≠ D118), K155 (≠ R146), I159 (≠ V150), K162 (= K153), R163 (≠ K154), R167 (= R158)
7e1sA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with octanoyl-acp (see paper)
42% identity, 95% coverage: 6:358/373 of query aligns to 11:365/366 of 7e1sA
- binding S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] octanethioate: L104 (≠ M88), A129 (= A113), G130 (= G114), I150 (= I141), I151 (≠ V142), S152 (= S143), E178 (= E169), H185 (= H176), G187 (= G178), Y280 (≠ M277), L328 (= L321)
- binding flavin mononucleotide: G25 (= G20), G26 (= G21), M27 (= M22), G28 (= G23), N102 (= N86), L104 (≠ M88), E178 (= E169), G183 (= G174), G223 (= G219), G224 (= G220), Q243 (= Q239), M244 (= M240), A245 (≠ G241), T246 (= T242)
- binding iron/sulfur cluster: C303 (= C300), N306 (≠ K303), C307 (= C304), V308 (≠ I305), C311 (= C308), G314 (vs. gap), A317 (≠ Q310), C323 (= C316), I324 (= I317)
7e1rA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with holo-acp (see paper)
42% identity, 95% coverage: 6:358/373 of query aligns to 11:365/366 of 7e1rA
- binding flavin mononucleotide: G25 (= G20), G26 (= G21), M27 (= M22), G28 (= G23), N102 (= N86), L104 (≠ M88), E178 (= E169), G183 (= G174), G224 (= G220), Q243 (= Q239), M244 (= M240), A245 (≠ G241), T246 (= T242), F342 (= F335)
- binding N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide: G128 (= G112), A129 (= A113), G130 (= G114), E178 (= E169), H185 (= H176), G187 (= G178)
- binding iron/sulfur cluster: C303 (= C300), N306 (≠ K303), C307 (= C304), V308 (≠ I305), C311 (= C308), G314 (vs. gap), A317 (≠ Q310), C323 (= C316), I324 (= I317)
7e1qA Crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori (see paper)
42% identity, 95% coverage: 6:358/373 of query aligns to 11:365/366 of 7e1qA
- binding flavin mononucleotide: G25 (= G20), G26 (= G21), M27 (= M22), G28 (= G23), N102 (= N86), L104 (≠ M88), E178 (= E169), S182 (≠ A173), G183 (= G174), G223 (= G219), G224 (= G220), M244 (= M240), A245 (≠ G241), T246 (= T242), F342 (= F335)
- binding iron/sulfur cluster: P277 (= P274), C303 (= C300), N306 (≠ K303), C307 (= C304), V308 (≠ I305), C311 (= C308), G314 (vs. gap), A317 (≠ Q310), C323 (= C316), I324 (= I317)
7l00C Crystal structure of c. Difficile enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
27% identity, 94% coverage: 14:362/373 of query aligns to 17:308/315 of 7l00C
- binding flavin mononucleotide: G23 (= G20), G24 (= G21), M25 (= M22), A26 (≠ G23), N74 (= N86), E142 (= E169), G146 (≠ A173), G147 (= G174), G174 (= G219), G175 (= G220), Q194 (= Q239), G196 (= G241), T197 (= T242), M281 (≠ F335), S285 (≠ N339)
- binding N-[6-(methylsulfonyl)-1,3-benzothiazol-2-yl]-2-[2-(1H-pyrrol-1-yl)-1,3-thiazol-4-yl]acetamide: A26 (≠ G23), M76 (= M88), G100 (= G112), A101 (= A113), G102 (= G114), V121 (≠ I141), P123 (≠ S143), H149 (= H176), L266 (≠ A320), M281 (≠ F335)
5gvhA Structure of fabk from thermotoga maritima (see paper)
28% identity, 95% coverage: 16:371/373 of query aligns to 15:311/311 of 5gvhA
- binding flavin mononucleotide: G19 (= G20), G20 (= G21), M21 (= M22), A22 (≠ G23), N70 (= N86), I72 (≠ M88), E138 (= E169), S142 (≠ A173), G143 (= G174), G170 (= G219), G171 (= G220), Q190 (= Q239), G192 (= G241), T193 (= T242), M275 (≠ F335), S279 (≠ N339)
2z6iB Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) (see paper)
27% identity, 91% coverage: 16:356/373 of query aligns to 14:302/321 of 2z6iB
- binding calcium ion: E137 (= E169), H144 (= H176), A158 (≠ V199), I161 (≠ V202)
- binding flavin mononucleotide: G18 (= G20), G19 (= G21), M20 (= M22), A21 (≠ G23), N69 (= N86), E137 (= E169), A141 (= A173), G142 (= G174), G169 (= G219), G170 (= G220), G191 (= G241), T192 (= T242), M281 (≠ F335)
4iqlA Crystal structure of porphyromonas gingivalis enoyl-acp reductase ii (fabk) with cofactors NADPH and fmn (see paper)
31% identity, 73% coverage: 16:286/373 of query aligns to 13:236/313 of 4iqlA
- binding flavin mononucleotide: G18 (= G21), M19 (= M22), V20 (= V24), N68 (= N86), S94 (≠ G112), E136 (= E169), A140 (= A173), G141 (= G174), G170 (= G219), G171 (= G220), Q190 (= Q239), G192 (= G241), T193 (= T242)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: W21 (≠ G25), W21 (≠ G25), W25 (≠ S29), S44 (≠ M51), M45 (≠ K52), M45 (≠ K52), H46 (≠ E53), N49 (≠ A67), H52 (≠ R70), H53 (≠ E71), Y73 (≠ L91), P74 (≠ T92), E75 (≠ T93), S202 (≠ D251)
Sites not aligning to the query:
2z6jA Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor (see paper)
29% identity, 68% coverage: 16:270/373 of query aligns to 14:220/307 of 2z6jA
- binding calcium ion: A158 (≠ V199), I161 (≠ V202)
- binding flavin mononucleotide: G18 (= G20), G19 (= G21), M20 (= M22), A21 (≠ G23), N69 (= N86), E137 (= E169), A141 (= A173), G142 (= G174), G169 (= G219), G170 (= G220), G191 (= G241), T192 (= T242)
- binding 2-(4-(2-((3-(5-(pyridin-2-ylthio)thiazol-2-yl)ureido)methyl)-1h-imidazol-4-yl)phenoxy)acetic acid: N45 (≠ D55), M71 (= M88), L73 (≠ A90), A96 (= A113), G97 (= G114), V116 (≠ I141), P118 (≠ S143), L122 (≠ A147), E137 (= E169), H144 (= H176)
5lsmA Crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1
26% identity, 74% coverage: 15:290/373 of query aligns to 11:278/339 of 5lsmA
- binding flavin mononucleotide: A16 (≠ G20), P17 (≠ G21), M18 (= M22), A19 (≠ G23), N67 (= N86), H123 (vs. gap), A170 (= A173), G171 (= G174), G207 (= G219), G208 (= G220), G229 (= G241), T230 (= T242)
Sites not aligning to the query:
3bw2A Crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes (see paper)
29% identity, 54% coverage: 164:363/373 of query aligns to 162:342/347 of 3bw2A
Sites not aligning to the query:
3bw3A Crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes (see paper)
28% identity, 54% coverage: 164:363/373 of query aligns to 162:342/346 of 3bw3A
Sites not aligning to the query:
4q4kA Crystal structure of nitronate monooxygenase from pseudomonas aeruginosa pao1 (see paper)
33% identity, 35% coverage: 164:293/373 of query aligns to 171:292/351 of 4q4kA
Sites not aligning to the query:
Q9HWH9 Nitronate monooxygenase; NMO; Propionate 3-nitronate monooxygenase; P3N monooxygenase; EC 1.13.12.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
33% identity, 35% coverage: 164:293/373 of query aligns to 171:292/351 of Q9HWH9
Sites not aligning to the query:
2gjnA Crystal structure of 2-nitropropane dioxygenase complexed with fmn and substrate (see paper)
28% identity, 73% coverage: 16:286/373 of query aligns to 15:244/324 of 2gjnA
- binding flavin mononucleotide: G20 (= G21), M21 (= M22), Q22 (≠ G23), T73 (≠ M88), K122 (≠ S144), C147 (≠ A173), A148 (≠ G174), S176 (≠ A218), G177 (= G219), N197 (≠ Q239), M198 (= M240), G199 (= G241), T200 (= T242)
- binding 2-nitropropane: G149 (= G175), H150 (= H176)
Sites not aligning to the query:
Q9I4V0 NADH:quinone reductase; EC 1.6.5.9 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
29% identity, 69% coverage: 16:271/373 of query aligns to 17:231/328 of Q9I4V0
6e2aA Crystal structure of nadh:quinone reductase pa1024 from pseudomonas aeruginosa pao1 in complex with NAD+ (see paper)
29% identity, 69% coverage: 16:271/373 of query aligns to 16:230/326 of 6e2aA
- binding flavin mononucleotide: G21 (= G21), M22 (= M22), Q23 (≠ G23), T74 (≠ M88), K123 (≠ S144), C148 (≠ A173), A149 (≠ G174), S177 (≠ A218), G178 (= G219), N198 (≠ Q239), M199 (= M240), G200 (= G241), T201 (= T242)
- binding nicotinamide-adenine-dinucleotide: Q23 (≠ G23), L76 (≠ A90), P77 (≠ L91), Q79 (≠ E96), G150 (= G175), H151 (= H176)
Sites not aligning to the query:
4qitA Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
33% identity, 35% coverage: 164:293/373 of query aligns to 171:292/350 of 4qitA
Sites not aligning to the query:
4qiuB Crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form
33% identity, 35% coverage: 164:293/373 of query aligns to 170:291/350 of 4qiuB
Sites not aligning to the query:
6bkaA Crystal structure of nitronate monooxygenase from cyberlindnera saturnus (see paper)
21% identity, 75% coverage: 14:294/373 of query aligns to 15:313/374 of 6bkaA
- binding 3,6,9,12,15,18,21,24,27,30,33,36-dodecaoxaoctatriacontane-1,38-diol: T34 (≠ A34), R37 (≠ N37), V67 (vs. gap), D69 (vs. gap)
- binding flavin mononucleotide: A21 (≠ G20), P22 (≠ G21), M23 (= M22), A24 (≠ G23), N77 (= N86), F79 (≠ M88), H147 (vs. gap), Q190 (≠ E169), A194 (= A173), G195 (= G174), G196 (= G175), G239 (= G219), G240 (= G220), G261 (= G241), T262 (= T242)
Query Sequence
>8500002 FitnessBrowser__Miya:8500002
MPFPTLNIGDLVARIPIVQGGMGVGISLSRLASAVANEGGIGVIAAAMIGMKEPDVAKNP
IEANVRALRRELQKAREMTQGIVGVNIMVALTTFGEMVRTSIEERADIIFSGAGLPLDLP
RHLREACDQKKEEFRTKLVPIVSSARAASVIAKKWITRFDYVPDAFVVEGPKAGGHLGFK
AEEIDDPNHSLEAVIPQVVEAVKPFEDQKGCRIPVIAAGGVYTGEDITRFMELGAAGVQM
GTRFVATHECDADDRFKQAYVDATEQDVTIIKSPVGMPGRAIGNSFIDSMREGAKKPFKC
VFKCISTCEQEQTPYCIAAALINAMKGNLEKGFAFSGANVFRVDRIQSVHELVSSLQQEF
EEAISKRFGMLRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory