Comparing 8500047 FitnessBrowser__Miya:8500047 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
37% identity, 95% coverage: 5:244/252 of query aligns to 4:254/269 of B1VB61
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
37% identity, 95% coverage: 5:244/252 of query aligns to 6:256/281 of P0AER0
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
37% identity, 95% coverage: 5:244/252 of query aligns to 1:251/254 of 1fx8A
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
37% identity, 90% coverage: 8:235/252 of query aligns to 59:292/306 of I1CR68
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
35% identity, 96% coverage: 6:247/252 of query aligns to 20:268/301 of Q96PS8
6f7hC Crystal structure of human aqp10 (see paper)
35% identity, 96% coverage: 6:247/252 of query aligns to 5:253/253 of 6f7hC
8c9hA Aqp7_inhibitor
37% identity, 94% coverage: 3:239/252 of query aligns to 5:247/253 of 8c9hA
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
37% identity, 94% coverage: 3:239/252 of query aligns to 30:272/342 of O14520
Sites not aligning to the query:
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
38% identity, 92% coverage: 8:239/252 of query aligns to 4:241/249 of 6n1gA
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 95% coverage: 5:244/252 of query aligns to 4:254/264 of P37451
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
34% identity, 92% coverage: 8:240/252 of query aligns to 4:232/242 of 3c02A
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
32% identity, 95% coverage: 4:243/252 of query aligns to 2:244/245 of 2evuA
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
30% identity, 92% coverage: 8:240/252 of query aligns to 38:245/271 of P08995
Sites not aligning to the query:
P30301 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Homo sapiens (Human) (see 10 papers)
28% identity, 96% coverage: 1:241/252 of query aligns to 4:221/263 of P30301
Sites not aligning to the query:
P09011 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 96% coverage: 1:241/252 of query aligns to 2:219/261 of P09011
Sites not aligning to the query:
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 79% coverage: 3:201/252 of query aligns to 75:257/305 of Q9SAI4
P06624 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Bos taurus (Bovine) (see 4 papers)
27% identity, 96% coverage: 1:241/252 of query aligns to 4:221/263 of P06624
Sites not aligning to the query:
Q92R43 Aquaglyceroporin AqpS from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
37% identity, 43% coverage: 1:109/252 of query aligns to 1:110/233 of Q92R43
Sites not aligning to the query:
P55088 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Mus musculus (Mouse) (see 2 papers)
28% identity, 92% coverage: 8:239/252 of query aligns to 36:252/323 of P55088
Sites not aligning to the query:
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
39% identity, 39% coverage: 8:106/252 of query aligns to 5:103/230 of 3nkaA
Sites not aligning to the query:
>8500047 FitnessBrowser__Miya:8500047
MKELSLGREMVSEFMGTMVLIIFGAGNVAMTVLFGKGLNITWDNITFGWGLAVLLGIMAG
LPSGAHINPAVTVALAATGRFPWKKVLPYSAAQVAGGFAGAAIVFIDFHAKWVGVDPQLA
STAGIFCTFPAITTSYLPGFIDQIIGTAALMFGILAIGDFASKNNIGWIGGILVALLVVA
IGMSLGAMHGYAINPARDFGPRFFALVAGFTQPNLMEPGIVLVPIVGPLIGGPLGAFIYD
WTTGAVHKAQSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory