SitesBLAST
Comparing 8500048 FitnessBrowser__Miya:8500048 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 97% coverage: 16:542/542 of query aligns to 74:620/629 of Q9SS48
- S86 (≠ C28) mutation to F: In spd6-2; loss of 90% of activity.
- E546 (≠ M468) mutation to G: In spd6-1; loss of 90% of activity.
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
32% identity, 97% coverage: 12:535/542 of query aligns to 15:486/496 of 3da1A
- binding flavin-adenine dinucleotide: I24 (= I21), G27 (= G24), I28 (≠ A25), T29 (= T26), E48 (≠ D45), M49 (≠ R46), G55 (= G52), S57 (= S54), S60 (= S57), T61 (= T58), L63 (= L60), H65 (= H62), V151 (= V195), G187 (= G231), W189 (≠ M233), L193 (≠ V237), G210 (= G254), T250 (= T294), G296 (= G338), R298 (= R340), G319 (= G373), K320 (= K374), L321 (≠ W375)
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
31% identity, 98% coverage: 3:535/542 of query aligns to 7:548/557 of 2rgoA
- binding flavin-adenine dinucleotide: G25 (= G22), I28 (≠ A25), T29 (= T26), E48 (≠ D45), M49 (≠ R46), Q50 (≠ A47), T56 (= T53), S57 (= S54), A197 (≠ V195), S232 (≠ T230), G233 (= G231), W235 (≠ M233), G257 (= G254), G344 (= G338), L345 (= L339), Y357 (≠ Q352), K382 (= K374), I383 (≠ W375), T384 (= T376)
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
35% identity, 69% coverage: 8:383/542 of query aligns to 9:383/530 of 2rgoB
- binding flavin-adenine dinucleotide: G25 (= G24), I26 (≠ A25), T27 (= T26), E46 (≠ D45), M47 (≠ R46), Q48 (≠ A47), T54 (= T53), S55 (= S54), S58 (= S57), T59 (= T58), A193 (≠ V195), S227 (≠ T230), G228 (= G231), W230 (≠ M233), L338 (= L339), R339 (= R340), Y350 (≠ S350), K374 (= K374), I375 (≠ W375), T376 (= T376)
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
30% identity, 84% coverage: 39:495/542 of query aligns to 27:475/495 of 2r46A
- binding flavin-adenine dinucleotide: L32 (≠ V44), E33 (≠ D45), A34 (≠ R46), T41 (= T53), S42 (= S54), A44 (≠ R56), S45 (= S57), S46 (≠ T58), L48 (= L60), A172 (≠ V195), T206 (= T230), G231 (= G254), R317 (= R340), G353 (= G373), K354 (= K374), L355 (≠ W375), T356 (= T376)
- binding phosphoenolpyruvate: R54 (= R66), Y55 (= Y67), R254 (= R279), T270 (= T294), D272 (= D296), R317 (= R340), R332 (= R356)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ R180), V455 (= V475), D456 (≠ R476), H457 (≠ N477), W459 (≠ M479)
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
30% identity, 84% coverage: 39:495/542 of query aligns to 27:475/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (= R66), Y55 (= Y67), R254 (= R279), I255 (≠ V280), T270 (= T294), R317 (= R340), R332 (= R356)
- binding flavin-adenine dinucleotide: E33 (≠ D45), A34 (≠ R46), C39 (≠ Q51), A40 (≠ G52), T41 (= T53), S42 (= S54), A44 (≠ R56), S45 (= S57), S46 (≠ T58), L48 (= L60), A172 (≠ V195), T206 (= T230), G207 (= G231), W209 (≠ M233), G231 (= G254), R317 (= R340), G353 (= G373), K354 (= K374), L355 (≠ W375), T356 (= T376)
- binding phosphate ion: Q212 (≠ R239), G277 (≠ P301), P279 (≠ H303), V310 (≠ R333), Y398 (vs. gap), R401 (vs. gap), R405 (≠ E425), R462 (= R482), D464 (≠ V484), W468 (≠ V488)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ R180), V160 (≠ N183), V455 (= V475), D456 (≠ R476), H457 (≠ N477), W459 (≠ M479)
Sites not aligning to the query:
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
30% identity, 84% coverage: 39:495/542 of query aligns to 27:475/501 of 2qcuB
- binding flavin-adenine dinucleotide: E33 (≠ D45), A34 (≠ R46), C39 (≠ Q51), T41 (= T53), S42 (= S54), S45 (= S57), S46 (≠ T58), L48 (= L60), H50 (= H62), A172 (≠ V195), T206 (= T230), W209 (≠ M233), G231 (= G254), R317 (= R340), G353 (= G373), K354 (= K374), L355 (≠ W375), T356 (= T376)
- binding phosphate ion: R54 (= R66), Y55 (= Y67), R317 (= R340), R332 (= R356)
Sites not aligning to the query:
Query Sequence
>8500048 FitnessBrowser__Miya:8500048
MNRSGLLERLKSGREFDLLVIGGGATGCGVAVDAATRGLDVALVDRADFAQGTSSRSTKL
VHGGVRYLEKAVLQCDREQFGLVREGLRERGFLLANAPHLAHAVRLLTPVPTWKDAGYMF
AGLTLYDLLAGRLGLGHSKFVGKRAAERMFPTLRMGDYKAAVTYWDGQFNDARMAVALAR
TANAHGATCCNHVEVTHLIKEGGRLRGAELRDMLTGETWTLRARGIINATGPMADTVRRM
DDPGADEILKVSSGIHIVLEAGFTPPDLSLMIPKTEDGRVLFMIPWQNHVVFGTTDEHAN
PEHDPVPDVADIDYLLRYASKYLSRPVTRGDVRAVWSGLRPLVFAPGKGSTQELARTHVI
EVSPAGLLTIAGGKWTSYRMMAQDTVDRADVAFGLNLTRPCVTRHLKVVGARGFIPGGYT
EIAREYGVPVELAKALHGTYGDETGQVLTIARDENLGDRVHPDHPHIMAEVAFIVRNEMA
MRLVDVLVRRLPMGLLDVEHTLQAAPGVARIMAAELGWDAARTDAELQYLETYLSGWRAP
RD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory