Comparing 8500099 FitnessBrowser__Miya:8500099 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
65% identity, 97% coverage: 8:248/248 of query aligns to 1:240/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
60% identity, 97% coverage: 9:248/248 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
60% identity, 97% coverage: 9:248/248 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
60% identity, 97% coverage: 9:248/248 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
60% identity, 97% coverage: 9:248/248 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
58% identity, 97% coverage: 9:248/248 of query aligns to 1:240/240 of 4ymuJ
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
51% identity, 92% coverage: 17:244/248 of query aligns to 10:249/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
51% identity, 92% coverage: 17:244/248 of query aligns to 14:253/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 97% coverage: 9:248/248 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
41% identity, 97% coverage: 9:248/248 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
41% identity, 97% coverage: 9:248/248 of query aligns to 2:246/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
41% identity, 97% coverage: 9:248/248 of query aligns to 2:246/344 of 6cvlD
1g291 Malk (see paper)
37% identity, 95% coverage: 10:245/248 of query aligns to 4:241/372 of 1g291
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 98% coverage: 5:247/248 of query aligns to 13:251/378 of P69874
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 95% coverage: 10:244/248 of query aligns to 7:243/375 of 2d62A
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
38% identity, 87% coverage: 17:231/248 of query aligns to 12:226/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
38% identity, 87% coverage: 17:231/248 of query aligns to 12:226/230 of 6z4wA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 94% coverage: 13:244/248 of query aligns to 30:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 94% coverage: 13:244/248 of query aligns to 30:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 87% coverage: 20:235/248 of query aligns to 37:254/260 of 7ahdC
Sites not aligning to the query:
>8500099 FitnessBrowser__Miya:8500099
MTADSVEPIIRISHAWKFFGELTALNDVSLDVMPGEKVVICGPSGSGKSTLLRSINRLET
VDKGTIIVDGQDVNSPDNDINKIRQELGMVFQSFNLFPHKTVLQNLTMAPMRLRKTPRAE
AESRALELLKKVGISDKANVFPAMLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMI
GEVLDVMVTLAREGMTMVCVTHEMGFAREVADRIIFMDHGQVLEENAPQDFFGAPKHPRL
QKFLNQIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory