SitesBLAST
Comparing 8500111 FitnessBrowser__Miya:8500111 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
42% identity, 98% coverage: 9:454/454 of query aligns to 2:444/446 of 6yu6B
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
42% identity, 98% coverage: 9:452/454 of query aligns to 2:442/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
42% identity, 98% coverage: 9:452/454 of query aligns to 2:442/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S25), A19 (= A26), G21 (= G28), L22 (= L29), G23 (= G30), Y101 (= Y109), F223 (= F230), T224 (≠ K231), S226 (= S233), M229 (= M236), L321 (= L328)
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
43% identity, 97% coverage: 9:449/454 of query aligns to 2:439/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
43% identity, 97% coverage: 9:449/454 of query aligns to 2:439/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
43% identity, 97% coverage: 9:449/454 of query aligns to 2:439/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
43% identity, 97% coverage: 9:449/454 of query aligns to 2:439/441 of 4us3A
- binding sodium ion: G17 (= G24), A19 (= A26), V20 (= V27), V20 (= V27), G21 (= G28), N24 (= N31), T224 (≠ K231), D256 (= D263), A313 (= A320), S316 (≠ G323), S317 (≠ A324)
- binding tryptophan: S18 (= S25), A19 (= A26), L22 (= L29), G23 (= G30), Y101 (= Y109), F223 (= F230), T224 (≠ K231), S226 (= S233), M229 (= M236), S320 (= S327), L321 (= L328)
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
42% identity, 96% coverage: 17:452/454 of query aligns to 1:433/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (= A190), T180 (= T197), I287 (≠ L303), R288 (≠ P304), L289 (≠ G305)
- binding sodium ion: G8 (= G24), S9 (= S25), A10 (= A26), V11 (= V27), V11 (= V27), N15 (= N31), T215 (≠ K231), D247 (= D263), A304 (= A320), S307 (≠ G323), S308 (≠ A324)
- binding tryptophan: S9 (= S25), A10 (= A26), G12 (= G28), G14 (= G30), Y92 (= Y109), F214 (= F230), T215 (≠ K231), S217 (= S233), M220 (= M236), L312 (= L328)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/509 of 3gwuA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y109), F247 (= F230), T248 (≠ K231), S250 (= S233), F253 (≠ M236)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W33), R26 (≠ K34), Y104 (= Y109), F247 (= F230), A313 (≠ G288), D395 (= D381), D398 (= D384)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/509 of 3f4jA
- binding glycine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y109), F247 (= F230), T248 (≠ K231), S250 (= S233)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), G22 (= G30), N23 (= N31), T248 (≠ K231), N280 (≠ C262), A345 (= A320), G346 (≠ A321), T348 (≠ G323), S349 (≠ A324)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/509 of 3f3dA
- binding methionine: N17 (≠ S25), A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y109), F247 (= F230), T248 (≠ K231), S250 (= S233), S349 (≠ A324), I353 (≠ L328)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ K231), N280 (≠ C262), A345 (= A320), T348 (≠ G323), S349 (≠ A324)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/509 of 3f3cA
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ K231), N280 (≠ C262), A345 (= A320), T348 (≠ G323), S349 (≠ A324)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S25), A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y109), F247 (= F230), T248 (≠ K231), S250 (= S233), F253 (≠ M236), S349 (≠ A324), I353 (≠ L328)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 2:460/511 of 2qeiA
- binding alanine: A19 (= A26), G21 (= G28), G23 (= G30), Y105 (= Y109), F248 (= F230), T249 (≠ K231), S251 (= S233)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K34), V30 (≠ A37), Q31 (≠ L38), Y104 (≠ F108), R180 (≠ A167), R188 (= R175), F189 (≠ T176), F315 (≠ P289), F345 (≠ I319), D396 (= D381), D399 (= D384)
- binding sodium ion: G17 (= G24), A19 (= A26), V20 (= V27), V20 (= V27), G21 (= G28), N24 (= N31), T249 (≠ K231), N281 (≠ C262), A346 (= A320), T349 (≠ G323), S350 (≠ A324)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 2:460/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K34), V30 (≠ A37), Q31 (≠ L38), R188 (= R175), F189 (≠ T176), I192 (≠ V179), A314 (≠ G288), F315 (≠ P289), F345 (≠ I319), D396 (= D381)
- binding leucine: A19 (= A26), G21 (= G28), L22 (= L29), G23 (= G30), Y105 (= Y109), F248 (= F230), T249 (≠ K231), S251 (= S233), F254 (≠ M236)
- binding sodium ion: G17 (= G24), A19 (= A26), V20 (= V27), V20 (= V27), G21 (= G28), N24 (= N31), T249 (≠ K231), N281 (≠ C262), A346 (= A320), T349 (≠ G323), S350 (≠ A324)
3uspA Crystal structure of leut in heptyl-beta-d-selenoglucoside (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/503 of 3uspA
- binding heptyl 1-seleno-beta-D-glucopyranoside: K117 (= K122), L122 (vs. gap), E153 (≠ P147), I155 (vs. gap), K157 (≠ Q149), P158 (≠ S150), F161 (≠ W153), Y163 (≠ W155), H385 (≠ T363), H385 (≠ T363), L386 (= L364), F389 (= F375), F389 (= F375), L394 (≠ F380), D395 (= D381), D398 (= D384), P439 (= P426), Y442 (≠ F431)
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), F247 (= F230), T248 (≠ K231), S250 (= S233), F253 (≠ M236)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ K231), N280 (≠ C262), A345 (= A320), T348 (≠ G323), S349 (≠ A324)
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 3:461/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ K34), Q32 (≠ L38), R189 (= R175), F190 (≠ T176), I193 (≠ V179), F316 (≠ P289), F346 (≠ I319), L396 (≠ F380), D397 (= D381)
- binding leucine: A20 (= A26), G22 (= G28), G24 (= G30), Y106 (= Y109), F249 (= F230), T250 (≠ K231), S252 (= S233), F255 (≠ M236)
- binding sodium ion: G18 (= G24), A20 (= A26), V21 (= V27), V21 (= V27), G22 (= G28), N25 (= N31), T250 (≠ K231), N282 (≠ C262), A347 (= A320), T350 (≠ G323), S351 (≠ A324)
2qb4A Crystal structure analysis of leut complexed with l-leucine, sodium and desipramine (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/510 of 2qb4A
- binding 3-(10,11-dihydro-5h-dibenzo[b,f]azepin-5-yl)-n-methylpropan-1-amine: R26 (≠ K34), V29 (≠ A37), Q30 (≠ L38), I107 (≠ V112), R187 (= R175), F188 (≠ T176), I191 (≠ V179), A313 (≠ G288), F314 (≠ P289), F344 (≠ I319), D395 (= D381)
- binding leucine: A18 (= A26), G20 (= G28), L21 (= L29), G22 (= G30), Y104 (= Y109), F247 (= F230), T248 (≠ K231), S250 (= S233), F253 (≠ M236)
- binding sodium ion: G16 (= G24), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T248 (≠ K231), N280 (≠ C262), A345 (= A320), T348 (≠ G323), S349 (≠ A324)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/498 of 3gwvA
- binding leucine: A18 (= A26), G20 (= G28), G22 (= G30), Y104 (= Y109), F247 (= F230), T248 (≠ K231), S250 (= S233), F253 (≠ M236)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L29), R26 (≠ K34), A313 (≠ G288), F314 (≠ P289), L394 (≠ F380), D395 (= D381), D398 (= D384)
3mpnA F177r1 mutant of leut (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:459/505 of 3mpnA
- binding leucine: N17 (≠ S25), A18 (= A26), G20 (= G28), L21 (= L29), G22 (= G30), Y104 (= Y109), F247 (= F230), T248 (≠ K231), S250 (= S233), F253 (≠ M236), S349 (≠ A324)
- binding S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate: C171 (vs. gap), A377 (≠ S352)
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
31% identity, 97% coverage: 9:448/454 of query aligns to 1:458/504 of 3f3aA
- binding sodium ion: G16 (= G24), N17 (≠ S25), A18 (= A26), V19 (= V27), V19 (= V27), G20 (= G28), N23 (= N31), T247 (≠ K231), N279 (≠ C262), A344 (= A320), T347 (≠ G323), S348 (≠ A324)
- binding tryptophan: R7 (= R15), A18 (= A26), G20 (= G28), L21 (= L29), G22 (= G30), R26 (≠ K34), Y104 (= Y109), G242 (= G226), F246 (= F230), F246 (= F230), T247 (≠ K231), S249 (= S233), F252 (≠ M236), D265 (= D249), Q266 (= Q250), D267 (= D251), F299 (vs. gap), N303 (vs. gap), A306 (≠ G282), I307 (≠ F283), A310 (≠ S286), N314 (≠ S290), S348 (≠ A324), I352 (≠ L328), D397 (= D384), G401 (≠ S388), T402 (≠ N389), G432 (= G420)
Query Sequence
>8500111 FitnessBrowser__Miya:8500111
MAKQITTARDGFATRLGVLAATLGSAVGLGNIWKFPALTGQNGGASFLLVYVLATLLVGL
PVMISEIMLGRRARANAVGTFRQLAPKGQPWHLVGFSGVVAAFLIMGFYTDVAGWVFAYI
FKSLSGEIATTDPAVAAKAFEALVGDPVQSLLWQWGVLVLISVIIIAGVAQGIERTTKVL
MPVLLLLLVAVCARSLTLPKAAEGLAFLFTPDFSKITPGVILMALGLAFFKLSIGMGTMT
TYGSYFRNDQDIPLTATRVMLCDLTISILAGMAVFPAVFNFGFEPSAGPSLLFMTIPAVF
TSLPGGQVFMVIFFCLTAIAATGAMLSLLEVPVAWLAESFGMPRKRATILTSVTLAIIGL
PATLSMSTMANVKIFGMTVFDLYDFLSSNVLLPVGGIFICLFAGWVWGAANVKTELSNRG
QLLNGPIIAAFLTVVRWVSPVLVLLVLLKGLKVF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory