SitesBLAST
Comparing 8500239 FitnessBrowser__Miya:8500239 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
45% identity, 99% coverage: 3:460/464 of query aligns to 2:460/471 of P04805
- C98 (= C99) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C101) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C126) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (vs. gap) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (vs. gap) mutation to Q: No change in activity or in zinc content.
- H131 (≠ R129) mutation to Q: No change in activity or in zinc content.
- H132 (≠ G130) mutation to Q: No change in activity or in zinc content.
- C138 (≠ G136) mutation to S: No change in activity or in zinc content.
- S239 (= S238) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
44% identity, 99% coverage: 3:460/464 of query aligns to 2:460/468 of 8i9iA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
40% identity, 98% coverage: 4:460/464 of query aligns to 103:558/564 of 3al0C
- active site: S110 (= S11), K335 (= K239)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R7), A108 (= A9), P109 (= P10), G118 (= G19), T122 (= T23), E142 (= E43), Y276 (= Y180), R294 (= R198), G295 (= G199), D297 (= D201), H298 (= H202), L324 (≠ M228), I325 (= I229), L333 (= L237)
- binding : T144 (= T45), D145 (= D46), R148 (= R49), Y208 (≠ E107), P213 (≠ T112), K252 (= K156), M255 (≠ L159), I266 (≠ V170), K269 (≠ R173), S270 (= S174), Y276 (= Y180), D297 (= D201), H298 (= H202), L299 (≠ V203), S300 (= S204), N301 (= N205), K304 (= K208), R330 (≠ K234), P332 (≠ K236), G363 (= G267), W364 (= W268), R365 (≠ S269), E370 (= E274), S387 (≠ N291), K389 (≠ A293), V391 (≠ A295), I392 (≠ A296), K397 (= K301), W400 (= W304), R407 (= R311), E446 (= E347), K447 (≠ R348), Q453 (≠ D354), I457 (≠ V358), R509 (≠ H411), K520 (= K422), Q524 (≠ P426), R527 (= R429), V535 (≠ G437), T536 (≠ G438), G538 (= G440), L539 (= L441)
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
36% identity, 98% coverage: 6:460/464 of query aligns to 4:478/485 of 4griB
- active site: S9 (= S11), K253 (= K239)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (= E43), Y194 (= Y180), R212 (= R198), W216 (≠ H202)
- binding zinc ion: C105 (= C99), C107 (= C101), Y128 (= Y122), C132 (= C126)
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
46% identity, 76% coverage: 4:356/464 of query aligns to 3:346/380 of 4g6zA
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
39% identity, 96% coverage: 4:448/464 of query aligns to 2:463/484 of 2cfoA
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
39% identity, 96% coverage: 4:448/464 of query aligns to 3:464/485 of Q8DLI5
- R6 (= R7) binding
- Y192 (= Y180) binding
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
39% identity, 99% coverage: 4:462/464 of query aligns to 2:468/468 of 1g59A
- binding : D44 (= D46), R45 (≠ Q47), A46 (≠ E48), R47 (= R49), P109 (= P103), V145 (= V138), R163 (≠ K156), V166 (≠ L159), E172 (= E165), V177 (= V170), K180 (≠ R173), S181 (= S174), D182 (= D175), E207 (≠ D200), E208 (≠ D201), R237 (≠ L230), K241 (= K234), T242 (≠ K235), K243 (= K236), M273 (≠ L266), G274 (= G267), E282 (= E274), S299 (≠ N291), L300 (≠ S292), P303 (≠ A295), V304 (≠ A296), K309 (= K301), W312 (= W304), R319 (= R311), P357 (≠ E347), R358 (= R348), R417 (≠ H411), K426 (= K420), L427 (≠ F421), Q432 (≠ P426), R435 (= R429), L442 (= L436), E443 (≠ G437), T444 (≠ G438), P445 (= P439), G446 (= G440), L447 (= L441), F448 (≠ P442)
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
39% identity, 99% coverage: 4:462/464 of query aligns to 2:468/468 of 2cv2A
- active site: K246 (= K239)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R7), A7 (= A9), S9 (= S11), G17 (= G19), I21 (≠ T23), E41 (= E43), Y187 (= Y180), R205 (= R198), A206 (≠ G199), E208 (≠ D201), W209 (≠ H202), L235 (≠ M228), L236 (≠ I229)
- binding : S9 (= S11), T43 (= T45), D44 (= D46), R47 (= R49), V145 (= V138), R163 (≠ K156), Y168 (≠ F161), E172 (= E165), V177 (= V170), K180 (≠ R173), S181 (= S174), Y187 (= Y180), E207 (≠ D200), E208 (≠ D201), W209 (≠ H202), V211 (≠ S204), R237 (≠ L230), K241 (= K234), L272 (≠ R265), M273 (≠ L266), G274 (= G267), E282 (= E274), S299 (≠ N291), P303 (≠ A295), V304 (≠ A296), K309 (= K301), W312 (= W304), R319 (= R311), P357 (≠ E347), R358 (= R348), R417 (≠ H411), Q432 (≠ P426), R435 (= R429), L442 (= L436), E443 (≠ G437), T444 (≠ G438), G446 (= G440), L447 (= L441), F448 (≠ P442)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
39% identity, 99% coverage: 4:462/464 of query aligns to 2:468/468 of 2cv1A
- active site: K246 (= K239)
- binding adenosine-5'-triphosphate: P8 (= P10), S9 (= S11), G17 (= G19), T18 (≠ G20), I21 (≠ T23), R47 (= R49), A206 (≠ G199), W209 (≠ H202), L235 (≠ M228), L236 (≠ I229)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R7), A7 (= A9), E41 (= E43), Y187 (= Y180), R205 (= R198), W209 (≠ H202)
- binding : S9 (= S11), E41 (= E43), T43 (= T45), D44 (= D46), R47 (= R49), V145 (= V138), R163 (≠ K156), V166 (≠ L159), E172 (= E165), V177 (= V170), K180 (≠ R173), S181 (= S174), Y187 (= Y180), E207 (≠ D200), E208 (≠ D201), W209 (≠ H202), V211 (≠ S204), R237 (≠ L230), K241 (= K234), K243 (= K236), M273 (≠ L266), G274 (= G267), S276 (= S269), E282 (= E274), S299 (≠ N291), P303 (≠ A295), V304 (≠ A296), K309 (= K301), W312 (= W304), R319 (= R311), P357 (≠ E347), R358 (= R348), R417 (≠ H411), L427 (≠ F421), Q432 (≠ P426), R435 (= R429), L442 (= L436), E443 (≠ G437), T444 (≠ G438), G446 (= G440), L447 (= L441), F448 (≠ P442)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
39% identity, 99% coverage: 4:462/464 of query aligns to 2:468/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
39% identity, 99% coverage: 4:462/464 of query aligns to 2:468/468 of 1n78A
- active site: K246 (= K239)
- binding glutamol-amp: R5 (= R7), A7 (= A9), P8 (= P10), S9 (= S11), G17 (= G19), T18 (≠ G20), I21 (≠ T23), E41 (= E43), Y187 (= Y180), N191 (≠ V184), R205 (= R198), A206 (≠ G199), E208 (≠ D201), W209 (≠ H202), L235 (≠ M228), L236 (≠ I229)
- binding : S9 (= S11), T43 (= T45), D44 (= D46), R47 (= R49), V145 (= V138), R163 (≠ K156), V166 (≠ L159), Y168 (≠ F161), E172 (= E165), V177 (= V170), K180 (≠ R173), S181 (= S174), Y187 (= Y180), E207 (≠ D200), E208 (≠ D201), W209 (≠ H202), L210 (≠ V203), V211 (≠ S204), R237 (≠ L230), K241 (= K234), M273 (≠ L266), G274 (= G267), E282 (= E274), R297 (≠ N289), P303 (≠ A295), V304 (≠ A296), K309 (= K301), W312 (= W304), R319 (= R311), P357 (≠ E347), R358 (= R348), R417 (≠ H411), L427 (≠ F421), Q432 (≠ P426), R435 (= R429), L442 (= L436), E443 (≠ G437), T444 (≠ G438), G446 (= G440), L447 (= L441), F448 (≠ P442)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
39% identity, 99% coverage: 4:462/464 of query aligns to 2:468/468 of 1j09A
- active site: K246 (= K239)
- binding adenosine-5'-triphosphate: H15 (= H17), E208 (≠ D201), L235 (≠ M228), L236 (≠ I229), K243 (= K236), I244 (≠ L237), S245 (= S238), K246 (= K239), R247 (= R240)
- binding glutamic acid: R5 (= R7), A7 (= A9), S9 (= S11), E41 (= E43), Y187 (= Y180), N191 (≠ V184), R205 (= R198), W209 (≠ H202)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
39% identity, 99% coverage: 4:462/464 of query aligns to 2:468/468 of P27000
- R358 (= R348) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
37% identity, 100% coverage: 1:463/464 of query aligns to 1:468/488 of 8vc5A
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
33% identity, 99% coverage: 3:460/464 of query aligns to 2:497/502 of 6brlA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
38% identity, 53% coverage: 2:246/464 of query aligns to 14:248/308 of P27305
- E55 (= E43) binding
- Y182 (= Y180) binding
- R200 (= R198) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
38% identity, 52% coverage: 2:240/464 of query aligns to 2:230/290 of 4a91A
- active site: S11 (= S11), K229 (= K239)
- binding glutamic acid: R7 (= R7), A9 (= A9), S11 (= S11), E43 (= E43), Y170 (= Y180), R188 (= R198), L192 (≠ H202)
- binding zinc ion: C99 (= C99), C101 (= C101), Y113 (= Y122), C117 (= C126)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
37% identity, 48% coverage: 3:225/464 of query aligns to 10:228/455 of 3aiiA
Sites not aligning to the query:
2re8A Glutaminyl-tRNA synthetase mutant c229r with bound analog 5'-o-[n-(l- glutamyl)-sulfamoyl]adenosine (see paper)
32% identity, 42% coverage: 2:198/464 of query aligns to 18:222/529 of 2re8A
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: P25 (≠ A9), P26 (= P10), E27 (≠ S11), G35 (= G19), H36 (≠ G20), D59 (≠ E43), Y204 (= Y180), H208 (≠ V184), R222 (= R198)
- binding : E27 (≠ S11), T61 (= T45), N62 (≠ D46), L117 (≠ C101), P119 (= P103), R123 (≠ E107), R126 (= R110), T128 (= T112), L129 (≠ A113), G161 (= G136), P174 (vs. gap), F175 (≠ R148), I176 (≠ V149), V182 (= V155), R185 (≠ T158), M203 (≠ T179), Y204 (= Y180)
Sites not aligning to the query:
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: 223, 253, 254, 263
- binding : 6, 226, 228, 306, 309, 310, 311, 313, 314, 316, 319, 322, 329, 334, 362, 363, 392, 394, 395, 403, 405, 406, 435, 499, 501, 502, 527
Query Sequence
>8500239 FitnessBrowser__Miya:8500239
MTKVVTRFAPSPTGHLHIGGARTAIFNWLLARHFGGTFLLRIEDTDQERSLQEYTDSILA
SMRWLGLDWDGDLIYQSRRFDIYNGYIDRMLETGHAYWCECTPEEVEQMRETARERGLKP
KYDGRCRERGLGPGPGRVVRLKAPLTGRVVFEDVVKGTLAFDAAELDDMVLRRSDGTPTY
NMAVVVDDATMGVTHVLRGDDHVSNTPKQVLIYQALGLPLPIFGHVPMILGPDKKKLSKR
HGARAVIEYEQDGLLPQALVNYLVRLGWSFGDQEIFALQELVEKFTTDNLNSAPAAFDPD
KLQWLNAHYLRETPVDELARLAAPFVKAEGFDVAPERLATLVPLFRERASNLADLARVMR
FMLVDATALEHDPAAVAKALTAEGKAHVAALRGLLEQADPFDKAALEKVVHDYVEQGGLK
FKQVGPPLRVALAGSLGGPGLPEIMEVLGRAETLARLDRAAALA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory