SitesBLAST
Comparing 8500245 DvMF_1002 adenosylmethionine-8-amino-7-oxononanoate aminotransferase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
47% identity, 90% coverage: 32:473/491 of query aligns to 10:444/448 of 3du4A
- active site: F17 (= F39), Y146 (= Y174), E217 (= E246), D251 (= D280), A254 (= A283), K280 (= K309), A417 (≠ V446)
- binding 7-keto-8-aminopelargonic acid: L82 (= L105), Y146 (= Y174), G315 (= G344), S317 (≠ T346), R410 (= R439)
- binding pyridoxal-5'-phosphate: S112 (= S135), G113 (= G136), A114 (≠ S137), Y146 (= Y174), H147 (= H175), E217 (= E246), D251 (= D280), V253 (= V282), A254 (= A283), K280 (= K309), H316 (= H345), S317 (≠ T346)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
47% identity, 90% coverage: 32:473/491 of query aligns to 10:444/448 of P53555
- GA 113:114 (≠ GS 136:137) binding
- Y146 (= Y174) binding
- K280 (= K309) modified: N6-(pyridoxal phosphate)lysine
- G315 (= G344) binding
- HS 316:317 (≠ HT 345:346) binding
- R410 (= R439) binding
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
45% identity, 90% coverage: 27:470/491 of query aligns to 5:434/438 of 6zhkA
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
44% identity, 90% coverage: 32:473/491 of query aligns to 7:416/420 of 6wnnA
- active site: F14 (= F39), Y143 (= Y174), D223 (= D280), K252 (= K309)
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: F14 (= F39), W51 (= W77), S109 (= S135), G110 (= G136), A111 (≠ S137), Y143 (= Y174), H144 (= H175), D223 (= D280), V225 (= V282), K252 (= K309), R382 (= R439)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: H288 (= H345), S289 (≠ T346)
3dodA Crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis (see paper)
43% identity, 90% coverage: 32:473/491 of query aligns to 8:413/417 of 3dodA
- active site: F15 (= F39), E186 (= E246), D220 (= D280), A223 (= A283), K249 (= K309), A386 (≠ V446)
- binding pyridoxal-5'-phosphate: W52 (= W77), S110 (= S135), G111 (= G136), A112 (≠ S137), D220 (= D280), V222 (= V282), K249 (= K309), H285 (= H345), S286 (≠ T346)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 87% coverage: 36:464/491 of query aligns to 11:438/447 of 5lhaA
- active site: Y146 (= Y174), D253 (= D280), K282 (= K309), T319 (= T346)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G136), S114 (= S137), Y146 (= Y174), H147 (= H175), G148 (= G176), E220 (≠ P247), D253 (= D280), K282 (= K309), Y318 (≠ H345), T319 (= T346)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 87% coverage: 36:464/491 of query aligns to 13:440/449 of 5lh9D
- active site: Y148 (= Y174), D255 (= D280), K284 (= K309), T321 (= T346)
- binding pyridoxal-5'-phosphate: G115 (= G136), S116 (= S137), Y148 (= Y174), H149 (= H175), G150 (= G176), E222 (≠ P247), D255 (= D280), V257 (= V282), K284 (= K309)
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
39% identity, 91% coverage: 29:473/491 of query aligns to 7:425/429 of 6ed7A
- active site: Y17 (≠ F39), Y144 (= Y174), D245 (= D280), K274 (= K309)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ F39), W52 (≠ L76), W52 (≠ L76), Y144 (= Y174), D147 (= D177), A217 (= A252), K274 (= K309), R391 (= R439), F393 (≠ L441), F393 (≠ L441)
- binding pyridoxal-5'-phosphate: G112 (= G136), S113 (= S137), Y144 (= Y174), H145 (= H175), D245 (= D280), I247 (≠ V282), K274 (= K309)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
39% identity, 91% coverage: 29:473/491 of query aligns to 7:425/429 of P12995
- Y17 (≠ F39) mutation to F: Severely reduces the aminotransferase activity.
- W52 (≠ L76) binding
- GS 112:113 (= GS 136:137) binding
- Y144 (= Y174) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D177) mutation to N: Loss of aminotransferase activity.
- D245 (= D280) binding
- R253 (≠ K288) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K309) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G344) binding
- PT 308:309 (≠ HT 345:346) binding
- R391 (= R439) binding ; mutation to A: Reduces aminotransferase activity.
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
38% identity, 91% coverage: 29:473/491 of query aligns to 7:425/429 of 1dtyA
- active site: Y17 (≠ F39), Y144 (= Y174), E211 (= E246), D245 (= D280), A248 (= A283), K274 (= K309), Y398 (≠ V446)
- binding pyridoxal-5'-phosphate: G112 (= G136), S113 (= S137), Y144 (= Y174), H145 (= H175), D245 (= D280), I247 (≠ V282), K274 (= K309)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
38% identity, 91% coverage: 29:473/491 of query aligns to 7:424/427 of 1mlzA
- active site: Y17 (≠ F39), Y144 (= Y174), E210 (= E246), D244 (= D280), A247 (= A283), K273 (= K309), Y397 (≠ V446)
- binding pyridoxal-5'-phosphate: G112 (= G136), S113 (= S137), Y144 (= Y174), H145 (= H175), D244 (= D280), I246 (≠ V282), K273 (= K309), P307 (≠ H345), T308 (= T346)
- binding trans-amiclenomycin: W52 (≠ L76), W53 (= W77), Y144 (= Y174), K273 (= K309), R390 (= R439), F392 (≠ L441)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
38% identity, 91% coverage: 29:473/491 of query aligns to 7:424/427 of 1mlyA
- active site: Y17 (≠ F39), Y144 (= Y174), E210 (= E246), D244 (= D280), A247 (= A283), K273 (= K309), Y397 (≠ V446)
- binding cis-amiclenomycin: W52 (≠ L76), W53 (= W77), K273 (= K309), R390 (= R439), F392 (≠ L441)
- binding pyridoxal-5'-phosphate: G112 (= G136), S113 (= S137), Y144 (= Y174), H145 (= H175), D244 (= D280), I246 (≠ V282), K273 (= K309), P307 (≠ H345), T308 (= T346)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
38% identity, 91% coverage: 29:473/491 of query aligns to 7:413/416 of 1qj3A
- active site: Y17 (≠ F39), Y144 (= Y174), E201 (= E246), D235 (= D280), A238 (= A283), K264 (= K309), Y386 (≠ V446)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ F39), W52 (≠ L76), Y144 (= Y174), K264 (= K309), R379 (= R439), F381 (≠ L441)
- binding pyridoxal-5'-phosphate: G112 (= G136), S113 (= S137), Y144 (= Y174), H145 (= H175), G146 (= G176), D235 (= D280), I237 (≠ V282), A238 (= A283), K264 (= K309)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
34% identity, 92% coverage: 24:475/491 of query aligns to 3:419/420 of 6erkA
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
36% identity, 91% coverage: 27:474/491 of query aligns to 8:448/448 of 6io1B
- active site: L20 (≠ F39), Y151 (= Y174), D257 (= D280), K286 (= K309)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S135), G118 (= G136), A119 (≠ S137), N122 (≠ V140), Y151 (= Y174), H152 (= H175), D257 (= D280), V259 (= V282), I260 (≠ A283), K286 (= K309)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
39% identity, 91% coverage: 26:472/491 of query aligns to 5:423/425 of 4w1vA
- active site: Y18 (≠ F39), Y147 (= Y174), E210 (= E246), D244 (= D280), A247 (= A283), K273 (= K309), Y397 (≠ V446)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P38), Y18 (≠ F39), W54 (≠ L76), M81 (≠ T103), G83 (≠ L105), Y147 (= Y174), G306 (= G344), P307 (≠ H345), T308 (= T346), F392 (≠ L441)
- binding pyridoxal-5'-phosphate: G114 (= G136), S115 (= S137), Y147 (= Y174), H148 (= H175), E210 (= E246), D244 (= D280), I246 (≠ V282), K273 (= K309)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
39% identity, 91% coverage: 26:472/491 of query aligns to 5:423/425 of 4cxrA
- active site: Y18 (≠ F39), Y147 (= Y174), E210 (= E246), D244 (= D280), A247 (= A283), K273 (= K309), Y397 (≠ V446)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ F39), W54 (≠ L76), W55 (= W77), A216 (= A252)
- binding pyridoxal-5'-phosphate: G114 (= G136), S115 (= S137), Y147 (= Y174), H148 (= H175), E210 (= E246), D244 (= D280), I246 (≠ V282), K273 (= K309), P307 (≠ H345), T308 (= T346)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
39% identity, 91% coverage: 26:472/491 of query aligns to 5:425/427 of 4cxqA
- active site: Y18 (≠ F39), Y149 (= Y174), E212 (= E246), D246 (= D280), A249 (= A283), K275 (= K309), Y399 (≠ V446)
- binding 7-keto-8-aminopelargonic acid: W56 (≠ L76), Y149 (= Y174), G308 (= G344), T310 (= T346), R392 (= R439)
- binding pyridoxal-5'-phosphate: G116 (= G136), S117 (= S137), Y149 (= Y174), H150 (= H175), G151 (= G176), E212 (= E246), D246 (= D280), I248 (≠ V282), K275 (= K309), P309 (≠ H345), T310 (= T346)
6ge8A Crystal structure of mycobacterium tuberculosis bioa
39% identity, 91% coverage: 26:472/491 of query aligns to 6:421/422 of 6ge8A
- binding [(2~{S})-3-(1~{H}-indol-3-yl)-1-[(2~{E})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene]hydrazinyl]-1-oxidanylidene-propan-2-yl]azanium: Y19 (≠ F39), W58 (≠ L76), G118 (= G136), S119 (= S137), Y151 (= Y174), H152 (= H175), E208 (= E246), D242 (= D280), I244 (≠ V282), K271 (= K309), P305 (≠ H345), T306 (= T346)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 92% coverage: 19:472/491 of query aligns to 3:433/437 of P9WQ81
- Y25 (≠ F39) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (≠ L76) binding
- Y157 (= Y174) binding
- K283 (= K309) modified: N6-(pyridoxal phosphate)lysine
- G316 (= G344) binding
Query Sequence
>8500245 DvMF_1002 adenosylmethionine-8-amino-7-oxononanoate aminotransferase (RefSeq)
MSGRTIDTGMPGAAPTPPAATGATLRLRALDKAHVWHPFTQMRDWLAADPLVIGAAEGNR
LTDTDGVSYLDGVSSLWTNVHGHRHPRLDAAIRAQLDKVAHTTLLGLGSEPSIELAARLA
AIAPQGLTRVFYSDSGSTSVEVALKIAFQFHRQAPAHLGGDARRTRFLSLRNAYHGDTVG
AVALGGMALFHSIYAPLLFDTVKAESPYCYRCPFGRQAGSCERECITHMETLFARHGHEL
CAAVVEPLVQGAAGMLLQPPGWLRRVRELCDEHGVFLVADEVAVGFGKTGTLFACEQEGV
TPDFLCLAKGISGGYLPLAATLTTERVHDGFLARHEELRTFFHGHTYTGNPLACAAAIAS
LDVFEEERVMERLQPKIARLAARLDTLRDLPHVGDIRQRGVMTGIEMVRNRATKEAYDLA
LRVGHRVTLEARRRGVIIRPLGDVMVLMPPLSITDDEIDLLVGATGEAIRAVTERGATGG
LEGLPPMSGVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory