Comparing 8500253 FitnessBrowser__Miya:8500253 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
36% identity, 94% coverage: 22:415/421 of query aligns to 5:380/385 of 2yxxA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
36% identity, 94% coverage: 22:415/421 of query aligns to 6:381/386 of Q9X1K5
1knwA Crystal structure of diaminopimelate decarboxylase
34% identity, 92% coverage: 23:411/421 of query aligns to 19:410/421 of 1knwA
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
34% identity, 92% coverage: 23:411/421 of query aligns to 19:410/419 of 1ko0A
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
34% identity, 92% coverage: 23:411/421 of query aligns to 20:411/420 of P00861
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 94% coverage: 22:416/421 of query aligns to 27:429/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
33% identity, 94% coverage: 22:416/421 of query aligns to 23:425/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
33% identity, 94% coverage: 22:416/421 of query aligns to 23:425/434 of 1tufA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 99% coverage: 2:417/421 of query aligns to 9:444/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
34% identity, 99% coverage: 2:417/421 of query aligns to 8:443/446 of 1hkvA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
33% identity, 94% coverage: 21:414/421 of query aligns to 19:409/418 of 4xg1B
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 94% coverage: 22:417/421 of query aligns to 34:441/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 94% coverage: 22:417/421 of query aligns to 34:441/443 of 5x7mA
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
31% identity, 94% coverage: 21:417/421 of query aligns to 3:389/394 of 3c5qA
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
31% identity, 94% coverage: 21:417/421 of query aligns to 5:397/405 of B4XMC6
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
32% identity, 94% coverage: 21:414/421 of query aligns to 17:384/393 of 4xg1A
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
29% identity, 92% coverage: 30:418/421 of query aligns to 31:419/422 of 6n2aA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
28% identity, 93% coverage: 23:415/421 of query aligns to 39:450/458 of 8d5dA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
29% identity, 93% coverage: 23:415/421 of query aligns to 40:454/461 of 8d88A
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
29% identity, 93% coverage: 23:415/421 of query aligns to 40:454/462 of 8d4iA
>8500253 FitnessBrowser__Miya:8500253
MPNVRSTYTDAVGFFGRTTPEELAAAFGSPLYVYSEALLRKRCRDMKALSSHPGFFVNYS
AKANTNLSLLRIVREEGLVVDAMSPGEIHVNKAAGFTPDQILYVCNNVSEAELANAVSHG
LLVSVDSLSQLETLGRVNRGGKVMVRFNPGIGAGHHQKVVTAGKATKFGVDPSEASLAEL
RAILARHDMTLAGINQHIGSLFLEPEGYVAAADFLLSVAEKFDTVEVIDFGGGFGIPYRK
YEDQPRLDLAATAERLHALISGWSERTGYKGRFYIEPGRYVVAECGLLLGTVHATKNNGP
TRYVGTDLGFNVLARPVMYDAHHDIEVYRNNGTPDAALHPQTVVGNICESGDIMARERQL
PAIQEGDILGVLDAGAYGYAMSSTYNQRLRPAEVLIGLDGEPRLIRRREELADLMALFPD
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory