Comparing 8500255 FitnessBrowser__Miya:8500255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
41% identity, 95% coverage: 9:387/400 of query aligns to 4:373/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 95% coverage: 15:395/400 of query aligns to 48:428/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 93% coverage: 18:390/400 of query aligns to 55:427/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
37% identity, 95% coverage: 2:382/400 of query aligns to 3:380/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
33% identity, 98% coverage: 1:393/400 of query aligns to 5:396/398 of 6slfA
3ramA Crystal structure of hmra (see paper)
26% identity, 74% coverage: 2:295/400 of query aligns to 5:274/391 of 3ramA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
24% identity, 79% coverage: 26:342/400 of query aligns to 20:327/373 of 3rzaA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 61% coverage: 37:281/400 of query aligns to 27:275/377 of 7t1qA
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
23% identity, 88% coverage: 16:365/400 of query aligns to 6:350/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
23% identity, 88% coverage: 16:365/400 of query aligns to 6:350/376 of 4o23A
>8500255 FitnessBrowser__Miya:8500255
MESLSDRVRAAAPHIVDLRRRLHRIPETGFNEVRTAALVAEELAALGLPVRTGIAGTGVT
ALLDSGRPGPTVMLRADMDALPITEATGLPYASEHPGCMHACGHDMHMAMLLGAARVLAG
LAEQNPDALRGRILFLFQPAEEGPGGAAPMIEAGVLDDPGVDVCIGAHVWPEIPAGFVGV
KPGPLMAAMDRFELTVLGKGGHAANPHLCVDALETATQVVGALQRVVSRMTSPLEPVILT
IGELHAGTAYNVIPGEARMAGTVRAFAPEVRNRWEQRINQVAGGVCAAMGATHRLDFQWC
HPAVINDPRAAAEVRRAALDAVGADRVMEPVPTMGGEDFSMFLQRVPGCFFFVGCGGPGV
APVHNPCFAPDESCLPVGAEVLCRAAVQICARWDAPQAGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory