Comparing 8500289 FitnessBrowser__Miya:8500289 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
53% identity, 98% coverage: 3:392/397 of query aligns to 2:382/382 of 7ahhC
7aheC Opua inhibited inward facing (see paper)
53% identity, 98% coverage: 3:392/397 of query aligns to 2:382/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
63% identity, 65% coverage: 3:260/397 of query aligns to 2:259/260 of 7ahdC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 60% coverage: 31:267/397 of query aligns to 5:239/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 70% coverage: 50:326/397 of query aligns to 40:299/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
41% identity, 66% coverage: 4:267/397 of query aligns to 3:239/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 61% coverage: 23:264/397 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 59% coverage: 31:264/397 of query aligns to 6:232/384 of 8hplC
8hprC Lpqy-sugabc in state 4 (see paper)
39% identity, 56% coverage: 42:264/397 of query aligns to 18:234/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
39% identity, 56% coverage: 42:264/397 of query aligns to 18:234/362 of 8hprD
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 61% coverage: 23:264/397 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 61% coverage: 23:264/397 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 61% coverage: 23:264/397 of query aligns to 2:242/344 of 3tuiC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
36% identity, 59% coverage: 33:265/397 of query aligns to 12:244/375 of 2d62A
3c4jA Abc protein artp in complex with atp-gamma-s
42% identity, 55% coverage: 50:267/397 of query aligns to 26:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
42% identity, 55% coverage: 50:267/397 of query aligns to 26:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
42% identity, 55% coverage: 50:267/397 of query aligns to 26:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
42% identity, 55% coverage: 50:267/397 of query aligns to 26:241/242 of 2oljA
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
36% identity, 59% coverage: 31:265/397 of query aligns to 10:230/353 of 1vciA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 67% coverage: 1:266/397 of query aligns to 1:236/369 of P19566
Sites not aligning to the query:
>8500289 FitnessBrowser__Miya:8500289
MAKIEIRDLTKIFGPVPEKALAMVRAGKPKDEIYKRTKHAVGVNRATFDVDEGEIVVVMG
LSGSGKSTLVRCLNRLIEPTDGTVRIDGTDVTTLSVKDLRALRQRTFGMVFQNFALFPHR
TVLENAEYGLEVMGAAKATRRDKAAEALARVGLAGWEAARPGQLSGGMQQRVGLARALAL
DPDILLMDEAFSALDPLIRRDMQDELLRLQDDVRKTIVFISHDLDEALKIGDRIVLMRDG
AVVQVGTPEDILTSPADDYVARFVADVDIARVLTAGTVMKRSEAVAVLGVDGPRTALRKM
RNHAIATLFVLDRNHKLVGLVTADDIVEHLAGGERDLAAIMRTDITTVSTDAPASELIPL
MAGLPHPLAVTDERGRLAGVIVRGLLLGALAERGGNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory