Comparing 8500294 FitnessBrowser__Miya:8500294 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
38% identity, 95% coverage: 14:277/279 of query aligns to 1:262/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 92% coverage: 22:277/279 of query aligns to 5:258/267 of P0ADG4
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
41% identity, 92% coverage: 22:278/279 of query aligns to 4:256/258 of 3lv0A
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
38% identity, 92% coverage: 22:277/279 of query aligns to 5:258/262 of 2qflA
6tqoT Rrn anti-termination complex (see paper)
38% identity, 92% coverage: 22:277/279 of query aligns to 5:250/255 of 6tqoT
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
44% identity, 80% coverage: 55:278/279 of query aligns to 25:238/238 of 3luzA
Sites not aligning to the query:
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
43% identity, 83% coverage: 47:278/279 of query aligns to 18:234/234 of 3luzB
Sites not aligning to the query:
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 81% coverage: 51:277/279 of query aligns to 38:267/271 of Q9M8S8
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
33% identity, 78% coverage: 52:269/279 of query aligns to 38:258/277 of O55023
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
32% identity, 78% coverage: 52:269/279 of query aligns to 36:256/274 of 4as5A
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
30% identity, 90% coverage: 18:269/279 of query aligns to 5:254/266 of 1imdA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
30% identity, 90% coverage: 18:269/279 of query aligns to 5:254/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
30% identity, 90% coverage: 18:269/279 of query aligns to 5:254/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
30% identity, 90% coverage: 18:269/279 of query aligns to 5:254/272 of 1awbA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
30% identity, 90% coverage: 18:269/279 of query aligns to 9:258/277 of P29218
6zk0AAA human impase with ebselen (see paper)
30% identity, 90% coverage: 18:269/279 of query aligns to 6:255/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
30% identity, 90% coverage: 18:269/279 of query aligns to 7:256/274 of 4as4A
6giuA Human impase with l-690330 (see paper)
30% identity, 90% coverage: 18:269/279 of query aligns to 7:256/275 of 6giuA
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
33% identity, 91% coverage: 19:273/279 of query aligns to 17:273/288 of O14732
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
33% identity, 78% coverage: 52:268/279 of query aligns to 38:258/277 of P20456
>8500294 FitnessBrowser__Miya:8500294
MASSQPDSLVAFGGSLNLEDALAVALDAAKAGCAVLARGRSRLARVRTTTKSPGDITTEL
DARSEAAIFARIRQAYPDHARLGEESGDSTGDSGASPFRWIVDPLDGTVNYVHGIPYYAV
SVALEVNGVAVLGVVADPGRREFFTAVRGQGAFCNGRPVHVARRTRMDEAVVGTVVPPPK
WPGMEGYLEQFCAVARCAAGMRRGGAAALDLAYVAAGRLDGFFVVSLKRWDLSAGALLVR
EAGGAVADIDGHPDPLHANRLAAANSTLLPALLERLRSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory